(data stored in ACNUC7421 zone)

EMBL: FN667743.PE155

FN667743.PE155       Location/Qualifiers
FT   CDS_pept        complement(134707..135795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93023"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93023.1"
FT                   /translation="MGNYRGYTGRSQAVFSLQQEENNRKAIKKQSLEDFMNQFVMGLDI
FT                   GYSNLKMAMGHKGEEARTVVMPVGAGPLELMPQQLTGGAGTCIQVVIDGEKWVAGVEPD
FT                   RLQGWERELHGDYPSTKPYKALFYAALLMSEQKEIDVLVTGLPVSQYMEAELREALKAR
FT                   LEGEHQITPKRTVTVKSVVVVPQPAGAYMDIVSSTKDDDLLEIIQGGKTVVIDPGFFSV
FT                   DWVALEEGEVRYHSSGTSLKAMSMLLQETNRLIQEDHGGAPGIEKIEKAIRAGKTEIFL
FT                   YGEKVSIKDYFKKASAKVAQNALVPMRKSMREDGMDADVVLLAGGGAEAYQDAAKELFP
FT                   KSRIVLPKESVASNARGFWYCG"
     ttgggcaact acagaggcta tacaggccgg agtcaggctg tattctctct ccaacaagag        60
     gaaaacaatc gaaaagcaat caaaaagcaa tctttggagg atttcatgaa tcagtttgtt       120
     atgggtttgg atattggcta ctccaacctg aaaatggcta tgggtcataa aggtgaagaa       180
     gctcgtactg ttgttatgcc tgttggcgct ggtccactgg aactgatgcc acagcagtta       240
     actggtggcg ctgggacctg tattcaggtt gtgattgatg gggagaaatg ggttgctggt       300
     gttgaacctg accgtctgca agggtgggag cgtgagcttc acggtgacta cccatcaacg       360
     aaaccgtata aggctctttt ttacgctgca cttctgatgt cggaacagaa ggaaattgat       420
     gtactggtga caggtcttcc agtaagccag tacatggaag cggaactcag agaggcattg       480
     aaagctcggc tggagggtga gcaccagatt acacctaaac gaacggtaac ggttaagtct       540
     gtcgtggttg tgcctcaacc tgccggtgct tacatggata ttgtcagctc aacaaaggat       600
     gatgacctac tcgaaattat tcagggaggg aaaactgttg ttattgaccc cggatttttc       660
     tctgttgact gggttgcgct tgaagagggt gaagttcgct atcactcatc tggcaccagc       720
     ctaaaggcca tgtcgatgtt gctacaagaa actaatcgac tcatccagga ggaccacggt       780
     ggtgcgcctg gcatagaaaa gatcgaaaaa gcaattcgcg ccggtaagac tgaaattttt       840
     ctctatggtg agaaggtatc gatcaaagat tattttaaga aggcgtcagc caaagtggct       900
     caaaacgcat tagtccctat gcgtaagtca atgcgggaag acggaatgga tgctgatgtt       960
     gttctgctgg ctggtggtgg tgccgaagca taccaggatg cagccaaaga gctttttcct      1020
     aagagtagga tcgtactgcc caaagaatcc gtggcatcca atgccagggg cttctggtac      1080
     tgcggctaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page