(data stored in ACNUC7421 zone)

EMBL: FN667743.PE157

FN667743.PE157       Location/Qualifiers
FT   CDS_pept        136161..136727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0157"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93025"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93025.1"
FT                   /translation="MDRNWEGFEVSLPKERWLDLLDPKLEEERSEITEDLLEAEGREFV
FT                   TELRSKLDHAIAVLAVEAQQEADMYWNAHRSAREEASEDEQGRVGTRVRILGVSLVAEW
FT                   YRNRFVEQVPGQKKRVLSTHIKKGRGHAYSMSHFKKEPAWAQELIQQVESRYAALRQRA
FT                   TALAKIRRALNEYERLLNKTHNDEV"
     ttggatagga attgggaggg ttttgaggtg agtctaccaa aagagcgatg gctggatctg        60
     ctagatccta agctcgaaga agaacgatct gagataacag aggatctgct tgaggcagaa       120
     ggtcgagagt ttgtcacgga gttacggagc aaactggatc acgctatagc tgttcttgct       180
     gtcgaagcac agcaggaagc agatatgtac tggaacgcgc acaggtctgc gcgtgaagaa       240
     gcatcggagg acgaacaagg gcgcgttggt acacgagttc gcattctagg cgtatcactc       300
     gttgcagagt ggtatcgcaa cagatttgtc gaacaggttc caggtcaaaa gaaaagggtt       360
     ctatcaacac atatcaagaa gggccgaggt catgcctaca gcatgtcgca cttcaagaaa       420
     gaaccagctt gggcacaaga gcttatccag caagtagaaa gcaggtatgc cgcgttaaga       480
     caaagagcga cagcgttagc aaaaattcgc cgggcgctca acgagtatga gcgactgcta       540
     aacaagactc ataacgatga ggtgtaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page