(data stored in ACNUC7421 zone)

EMBL: FN667743.PE158

FN667743.PE158       Location/Qualifiers
FT   CDS_pept        136717..137019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0158"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93026"
FT                   /db_xref="GOA:D3VM74"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93026.1"
FT                   /translation="MRCNNMTVSVAATELAKLGKCETMIKRFAKHPRPAPAKRPQSPQG
FT                   TDNTLRGEFAHFRYEAAALRFMNSAAGAKRRIYQLVFAATVAAGVLTLLAAWTTS"
     atgaggtgta ataacatgac agtatctgta gcggccactg agctggcgaa gctcggcaaa        60
     tgcgaaacga tgataaaaag atttgctaag catcctcgcc ctgccccagc aaaacgccca       120
     caatcgccac aggggaccga taacaccctt agaggtgagt tcgcccattt tcggtatgaa       180
     gctgctgccc tgcgcttcat gaacagtgct gcgggggcta agcgtcgcat ctaccagcta       240
     gtgtttgcag caacggtagc agcgggagta ttgacactgc tggcggcatg gaccaccagc       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page