(data stored in ACNUC7421 zone)

EMBL: FN667743.PE160

FN667743.PE160       Location/Qualifiers
FT   CDS_pept        complement(138799..138984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0160"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93028"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93028.1"
FT                   /translation="MQCSHMPLDLIHCYPHGTPFFSTKFLKNRPFVQRTHIFVLAFVQR
FT                   THMFVLKRAVAPYTFY"
     gtgcagtgtt cccatatgcc tctggatctt atccactgtt atccacacgg aacccccttt        60
     ttttccacaa aatttttaaa aaacagacct ttcgtgcagc gtacccatat atttgtgttg       120
     gcgttcgtgc aacgtaccca tatgtttgtc cttaaacgtg cagtcgcccc atatactttc       180
     tactaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page