(data stored in ACNUC7421 zone)

EMBL: FN667743.PE163

FN667743.PE163       Location/Qualifiers
FT   CDS_pept        141149..141757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93031"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93031.1"
FT                   /translation="MKAIKRFIIWVNYGLEGWSIFGSSDDWDEAVSIRSEAIDECSIDE
FT                   DDIILAENKNELVVKPAAKQMTEWHRELEAVLMTLDDCQMECDGMTWAVSHLLNEAGVP
FT                   HDCMYGFVRNEQTKDIVTPHFWVVLDDGWLVDLRLRMWLGDHDNIPHGVFHTDNEPGFF
FT                   YKGDPVQNHKGMRLGKAVLDIMTDGKLSHVKVPERQDGE"
     atgaaagcga taaagcggtt catcatatgg gttaattacg ggcttgaggg ctggagcatt        60
     tttggttcaa gcgatgactg ggatgaagct gtatccatcc gctcagaagc tatagacgaa       120
     tgcagcattg atgaagatga catcatcctg gctgagaaca aaaacgagct agtggtgaag       180
     ccagcggcta aacagatgac agagtggcac cgagagctgg aagctgtcct tatgacactt       240
     gacgactgcc aaatggaatg tgacggcatg acatgggcgg taagtcacct actgaacgaa       300
     gctggtgtcc cgcatgactg catgtatgga tttgtgcgaa acgaacagac caaggacatc       360
     gttacacctc atttttgggt tgtcctggat gacggttggc tggtggatct taggcttcgc       420
     atgtggcttg gcgatcacga caacatccct cacggggtat tccataccga taacgaaccc       480
     ggatttttct acaagggaga ccctgttcaa aaccataaag ggatgagatt gggcaaagct       540
     gtcctggaca tcatgaccga cggaaaactt tcacatgtga aagttcctga acgacaagac       600
     ggagaataa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page