(data stored in ACNUC7421 zone)

EMBL: FN667743.PE166

FN667743.PE166       Location/Qualifiers
FT   CDS_pept        142732..142851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0166"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93034"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93034.1"
FT                   /translation="MAPLPIDPFWSGKTLLFLWRKVSHVKVFFVKNRLPELGS"
     gtggcaccgc taccaatcga tccgttctgg tcaggtaaaa ccctcctgtt cctgtggcgg        60
     aaagtttcac atgtgaaagt tttttttgtg aaaaatcggt tgcccgaatt gggcagttag       120
//

If you have problems or comments...

PBIL Back to PBIL home page