(data stored in ACNUC7421 zone)

EMBL: FN667743.PE167

FN667743.PE167       Location/Qualifiers
FT   CDS_pept        142906..143379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0167"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93035"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93035.1"
FT                   /translation="MAQLKHNRLVMLGSLMATVVAAANGLSFITLMAGGITLLQFLAWK
FT                   QQDAVQSRFKAAKNAFETLNVIAFDKHWVGSTATVAKVSNMLTPAERLDKPWAVQVLAV
FT                   AEGGTWFAVDLQVTGTNKVQMLSLHQLSEKAAKTMLAFDLEVYEKFFGKPDVA"
     gtggctcaac ttaaacataa ccgcttagtc atgttggggt ccctgatggc aacagttgta        60
     gctgccgcta atgggttgag ctttatcacc cttatggctg gtggaataac ccttctccag       120
     ttcttggctt ggaagcaaca agatgctgtc cagagtcgtt tcaaggctgc gaagaatgct       180
     tttgaaacgt tgaacgtcat tgcgttcgac aagcactggg taggttcaac cgcgacggtt       240
     gcaaaagtgt cgaacatgct taccccggca gaaagacttg ataaaccttg ggcggtacaa       300
     gttctggcag tagccgaagg tggaacctgg ttcgcagttg acctgcaagt gactggtact       360
     aacaaagttc agatgctcag tctccaccag ctcagtgaaa aggcagcaaa gactatgttg       420
     gcctttgacc tcgaagtgta tgagaaattt ttcggaaaac ctgatgttgc atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page