(data stored in ACNUC7421 zone)

EMBL: FN667743.PE168

FN667743.PE168       Location/Qualifiers
FT   CDS_pept        143300..143683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0168"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93036"
FT                   /db_xref="GOA:D3VM84"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93036.1"
FT                   /translation="MKRQQRLCWPLTSKCMRNFSENLMLHEENVMEKIKNVDAVEFTVE
FT                   DKKAMTHAAYAQCIFILAQALAFPSLGMAGAMVAALCGMMPWLTKFAKEAPSKAFGMVM
FT                   ASLCIAPVYGKLCELVIHAIQGA"
     gtgaaaaggc agcaaagact atgttggcct ttgacctcga agtgtatgag aaatttttcg        60
     gaaaacctga tgttgcatga ggaaaatgtg atggaaaaaa tcaaaaacgt agatgctgtg       120
     gaattcacag tagaagataa aaaagcgatg acccatgcgg catacgccca gtgtatcttc       180
     attctggccc aagcgcttgc tttcccttcc ctggggatgg ctggcgctat ggttgcagct       240
     ttatgcggca tgatgccgtg gctgactaaa ttcgctaaag aagccccgtc gaaagccttt       300
     ggtatggtga tggcttcact ctgtattgca cctgtttacg ggaagctctg tgagcttgtg       360
     atccacgcga ttcagggagc ttga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page