(data stored in ACNUC7421 zone)

EMBL: FN667743.PE169

FN667743.PE169       Location/Qualifiers
FT   CDS_pept        143688..144539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0169"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93037"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93037.1"
FT                   /translation="MGLVRVPYLLAELKERGGDESALAKIMQPGCRIGEEDLRALASKL
FT                   GIEISSLAPAPENAANTRFKAKLRGGLASFLFEYDGCFRHAEGSSHAEMLGIEQEDDIG
FT                   LPSRAADAMLLEKTLYQVIARAKYMLSKIDSKFVRSEQAIEFREQLAPGIFKPGYRGFR
FT                   FKEAASGDLPTVMIDGRKFNCIASIARAHGLDPVTVRRRIADTGKTAEKLTNDEWKLIL
FT                   SKKKGKGKPFTYQDRTYSNIAQFCREYQLNSNLVYQKVKDRADSTDEEFWGQIIETCKR
FT                   ND"
     atggggctag tacgagttcc ctatctcttg gctgagctta aagaacgcgg cggtgatgaa        60
     tctgctctgg ctaagatcat gcagcccggt tgcaggattg gagaggaaga cctgagagcg       120
     ttggcctcca aattagggat tgaaatatcc tctctggctc cagcgccaga gaatgcggcc       180
     aatacccggt tcaaagcaaa gctgagagga ggtttggcct cctttctttt tgagtatgac       240
     gggtgttttc gacatgccga aggctccagc catgcagaaa tgctgggtat cgagcaagaa       300
     gacgatattg gtcttccgag tcgagctgct gatgccatgc tcctggaaaa gactctctac       360
     caagtgatag ctcgggccaa atacatgctg agcaagatcg acagcaaatt tgttcggtca       420
     gaacaggcaa tagagttccg tgaacaactt gctccaggga tcttcaaacc tggttacaga       480
     gggttccggt tcaaggaagc tgcttctggt gatttgccta ctgtcatgat tgatggtcgg       540
     aaattcaatt gcatagccag tatagccaga gcacatggac ttgatccggt tacagtgcgg       600
     agacgcattg cggataccgg aaagaccgca gaaaaactca ccaatgatga gtggaaactc       660
     atcctttcaa agaaaaaagg taaaggaaaa cccttcacct accaggatag aacctacagc       720
     aatattgctc agttctgtcg tgagtatcag ctcaacagca accttgttta ccagaaagtc       780
     aaagatcggg ctgatagcac tgatgaagag ttctggggac agattattga aacatgcaaa       840
     aggaacgact aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page