(data stored in ACNUC7421 zone)

EMBL: FN667743.PE17

FN667743.PE17        Location/Qualifiers
FT   CDS_pept        12847..13224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0017"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92885"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92885.1"
FT                   /translation="MNVTKKIHLLALGLFMTGTAIAAPDVLNDDAKLKNLEKVCPDCEM
FT                   VAKDVLNLRVQNCQLKDTSSAMMIGTMQNDPMFSFMLAVHTAAGSEAYKTVVGAAGNHV
FT                   DCENPLNWIKLTQQAIKGGKV"
     atgaacgtaa ccaagaaaat tcatctgctg gcgctgggat tgtttatgac cggtactgcc        60
     atcgctgcac ctgatgtact caatgacgat gcaaagctca aaaaccttga gaaggtgtgc       120
     cctgactgtg aaatggtggc aaaagatgtg ctcaatcttc gggttcaaaa ctgccagcta       180
     aaagatacct ccagtgcaat gatgatagga actatgcaaa atgaccctat gttttcgttt       240
     atgctggcgg tacacactgc ggcaggctcg gaggcataca aaacagtagt tggtgccgct       300
     ggcaaccatg ttgactgtga aaacccgttg aactggatca agctgaccca gcaagcaatt       360
     aaaggaggca aagtctaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page