(data stored in ACNUC7421 zone)

EMBL: FN667743.PE180

FN667743.PE180       Location/Qualifiers
FT   CDS_pept        complement(150229..150540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0180"
FT                   /product="Helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93048"
FT                   /db_xref="GOA:D3VM96"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93048.1"
FT                   /translation="MNVMARTLDQMLATEKPDVVAKAQKAATEMLLNIHLAELRSRMKI
FT                   TQGEIAASLGVKQPTVSDMEKPGRDLKLSSIKRYVEASGGKLRLDVELPDGTHYGFSV"
     gtgaacgtta tggcaagaac tcttgaccaa atgctggcaa cagaaaagcc tgatgttgtt        60
     gccaaagcac agaaagcggc gactgaaatg ttgctgaaca tccacctagc agagcttcgt       120
     tctcgcatga aaatcaccca aggtgaaatt gctgcttctc tgggggtgaa acaaccgaca       180
     gtctctgata tggagaaacc tggacgagat ctaaaacttt cgtccattaa gcgctacgtt       240
     gaggcatccg gcggtaagct gcgactcgat gtggaactgc cggacggcac ccactacggt       300
     ttttctgttt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page