(data stored in ACNUC7421 zone)

EMBL: FN667743.PE181

FN667743.PE181       Location/Qualifiers
FT   CDS_pept        complement(150537..150887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93049"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93049.1"
FT                   /translation="MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYAD
FT                   TVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGILLCAGNKTGDEKRFYEVMIPIADR
FT                   EFAAHLDKLKKE"
     atgtgggcca tcgagacaac cgacaccttt gatgagtggt tcgatgctct ggatgatact        60
     gacagagcca acgtccttgc ttcgatgatg gtacttcgtg acagaggtcc tatgctttcg       120
     aggccatacg ctgacactgt gaacggttca tcctacagca acatgaaaga gctacgggtt       180
     caaagcaaag gagatcctct cagagcgttc tttgcattcg atccaaagcg taaggggatt       240
     cttctctgtg ccggtaataa gactggggat gagaaacgat tttatgaagt aatgatccca       300
     attgcagacc gtgaatttgc ggcgcacttg gataaattaa agaaggagtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page