(data stored in ACNUC7421 zone)

EMBL: FN667743.PE19

FN667743.PE19        Location/Qualifiers
FT   CDS_pept        14222..14569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92887"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92887.1"
FT                   /translation="MNVNKQFFWFLMNVVLMCIQAQQIKNDRVTMRFEPRFVEYEPKSD
FT                   KVFVYGYSYVKGASSNEERSERSYEFAIKISNYAPVLDYIDTYVGKPRTKAVLEQLQRK
FT                   EENRRKNEEQR"
     gtgaacgtta ataaacagtt tttctggttt ctgatgaacg tggtgcttat gtgcattcaa        60
     gctcagcaga tcaaaaacga ccgagtaacc atgaggttcg agccgagatt tgttgagtat       120
     gagcccaaga gcgacaaggt ttttgtctac ggatattcct atgtcaaagg ggcttcttct       180
     aacgaggaac gtagcgaacg ctcctacgag ttcgctatca aaatttcaaa ctacgcgccc       240
     gtgctggact acatcgacac ctatgtagga aagccacgca ccaaagctgt tttggagcaa       300
     ctccagcgca aagaagagaa ccggagaaag aatgaagaac aacgctaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page