(data stored in ACNUC7421 zone)

EMBL: FN667743.PE2

FN667743.PE2         Location/Qualifiers
FT   CDS_pept        940..2115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0002"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92870"
FT                   /db_xref="GOA:D3VLR8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92870.1"
FT                   /translation="MALNNLRGLSDLAKAAKGKKGKEVLTVPVDDVVSKVQVRKRFRNI
FT                   EELAATMLTEGQQSPIIVFPKNEEGKFVIQKGERRWRACKHAGIDTIDLVVNDKVQNNL
FT                   DETAGELIENIQRDDLTPVEIAEALNLFIEDGWKQKDIADRLGKNITFVSTHLSLLKLP
FT                   DCVRELYDNEVCSDTETLNNLRLLFDMNEERCRAVCAVAMSDGITRKQSRELLNDAKRI
FT                   KEEMEKGPLTGSGHNDEPGDGNTDDQTLNSNGNGTEEQLGNAEQNHNQNVLEDGSDRDG
FT                   LNDDDLDPLRDEEDKEPVQQPINSGKNKDDEGGDALPPLPKDKEWKNVRADSLVIAVNV
FT                   NLDGETKRGVIMTDRVALVPSTVWVKTLDSEGKEKHVHVPVSDIELLSVEG"
     atggcattaa ataatttgag aggcctgtcg gatcttgcta aagctgccaa aggcaagaaa        60
     ggtaaagaag ttcttactgt gccagttgac gacgttgttt ccaaagtcca ggtgcgtaag       120
     cgcttccgta acattgaaga gttggcagcg actatgctga ccgaggggca gcagtctcct       180
     atcatcgtgt ttcctaagaa tgaggaagga aagttcgtca ttcagaaggg ggagcgacgt       240
     tggagagcat gtaaacatgc aggtattgat actatcgatc tggttgtcaa tgataaggtc       300
     cagaataatc tggacgaaac tgctggcgag ttgatcgaaa acatccaaag agatgaccta       360
     acgccggtag aaatagccga ggcattgaat ctgtttattg aagatggttg gaagcaaaaa       420
     gacattgctg atcgcctcgg gaaaaacatc actttcgtat ctacgcattt gtcattgcta       480
     aagctacctg actgtgtgcg cgagttgtat gataatgaag tttgttctga tacagaaacc       540
     ctgaataatc ttcgtctttt gttcgatatg aacgaagaac gctgccgtgc tgtctgtgct       600
     gtggctatgt ctgacgggat cacccggaaa caaagtcgtg agcttctgaa cgatgccaag       660
     cgcatcaaag aagaaatgga aaaaggccct ctgactggct ccggccacaa tgatgaacct       720
     ggtgatggaa ataccgatga ccaaacccta aactcaaatg ggaatggtac ggaggaacaa       780
     ctgggtaatg ccgagcagaa ccataaccag aatgtgttgg aagacggttc agaccgtgat       840
     ggtctgaatg acgatgattt ggaccctttg cgcgatgaag aggacaaaga gcctgtccag       900
     cagcctatta acagcggaaa gaacaaagat gatgaaggtg gtgatgctct tcctcctctg       960
     ccgaaggaca aagagtggaa gaatgtccga gccgacagtt tggttattgc tgtcaacgtt      1020
     aacctggatg gtgaaactaa acgcggagtc atcatgacag accgtgtggc tctggttcca      1080
     tctactgtct gggtcaaaac gctcgatagt gaaggaaagg aaaagcatgt tcatgtgcct      1140
     gtgtcagaca ttgaactcct tagtgtcgaa ggctaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page