(data stored in ACNUC7421 zone)

EMBL: FN667743.PE21

FN667743.PE21        Location/Qualifiers
FT   CDS_pept        15467..16783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0021"
FT                   /product="Sex pilus assembly protein (Fragment) (modular
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92889"
FT                   /db_xref="GOA:D3VGJ7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92889.1"
FT                   /translation="MIKRFWTELDPQKKRWVAIAGGLFVLFAVVTMFSGEPKKEEKRGR
FT                   QETIKHVLTDKNTREIGIDSLSADVKMVSRENSDLKKELEKVKRELEQTKDTAGKSSDV
FT                   GREISRLRQDLDRLTQKNMELSKKVETGEAGGKTASSTGDARADVNGTSDGEGQFMEKK
FT                   LDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKSGIQIVSYSQKAPEVEAKDDKDDE
FT                   SLYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIVS
FT                   GYGDLSSERAYLRGETFSCVREDGGIIEARLDSYAVGEDGKAGVRGRVVSKQGQIIAKS
FT                   LMAGFLGGVSEAFDVNPVPVVNTNPGSNTQYQSIFSGQMLQGAAVKGASNALNRIAQFY
FT                   IDMAEGIFPVIEVDAGRQVDIIVTKGTKLQIRSTGGNKK"
     atgatcaaac gattctggac tgagctagac ccccaaaaga aacgctgggt agcaattgct        60
     ggtggtctat tcgttctttt tgcagtagtg acgatgttct ctggtgagcc gaagaaggaa       120
     gaaaaacgtg gtaggcaaga aaccatcaag catgttctta cagacaaaaa tacccgtgag       180
     atcgggatag attcgctgtc tgccgatgtg aagatggtgt ctcgtgagaa ctcagacctg       240
     aaaaaggagc tggagaaagt caaaagagag ctggagcaaa caaaggatac tgccggtaaa       300
     tccagcgatg ttggcagaga gatttctcgt ctacgccaag accttgaccg cctaacccag       360
     aaaaatatgg agctgtctaa gaaggttgaa actggtgagg ctggtggaaa aacagcttct       420
     tcaacagggg atgccagagc cgatgttaat ggcacatcag acggtgaagg tcagttcatg       480
     gagaaaaagc tggactacaa agatccggca tcatttttcc gtgacgcacc actcccggac       540
     tcgaagggtg gagctcctgc aacaggcaaa ggtgatggcc gtgatgccac caaatctggt       600
     attcaaattg tgagctactc acagaaggca ccagaagttg aagcgaaaga cgacaaggat       660
     gatgagtccc tctatctgcc gtctggctcc atcctgacag gtgtgcttat caacggtatg       720
     gatgcaccta cttcccaggg tgcccgacga gatccattcc cttcaacgct tcggattcag       780
     aaagaagcca tattgcctaa tcgtttccgt gcggatgtca gagagtgctt cctgattgtt       840
     tcaggctatg gcgaccttag ttctgaacga gcctacctac gtggtgagac attctcttgt       900
     gtccgggaag acggggggat aatcgaagcg aggcttgact cttatgcggt aggcgaggat       960
     ggcaaggctg gtgttcgagg ccgcgttgta tcgaagcaag ggcagattat tgccaagagc      1020
     ctgatggcag gattcctcgg tggcgtgtct gaggcctttg atgttaatcc tgtgcctgtt      1080
     gttaacacta accctggctc aaatacccag tatcagtcta ttttctctgg ccagatgttg      1140
     cagggggccg ctgtgaaggg agccagtaat gccctgaatc gtatcgctca attctatatc      1200
     gacatggccg aaggcatctt tccggtcatc gaagtcgatg ctggccgcca agtagacatc      1260
     attgtgacca aaggcaccaa gctacaaatt cgttccactg ggggcaataa gaaatga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page