(data stored in ACNUC7421 zone)

EMBL: FN667743.PE25

FN667743.PE25        Location/Qualifiers
FT   CDS_pept        18275..19045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0025"
FT                   /product="Integrase, catalytic domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92893"
FT                   /db_xref="GOA:D3VLU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92893.1"
FT                   /translation="MAQCCRYLSITRQAYYQQCQRAAIKEKQEQEVLRRVQSIRLQQPR
FT                   IGTRKLQYLLNQSSPLKIGRDSLFDLLRTHRLLVKPRRAYHKTTQSHHRFHCHPNLLKA
FT                   GPNKITPTGPEQVWVADITYLPVKAGEAYLSLITDAWSRKIVGYHVHDNLSTGSVIQAY
FT                   KHALKSRKLIEQSLIHHSDRGLQYCSKHYQALHQHHEIICSMTDGYDCYQHALAERVNG
FT                   ILKTEFLLCKPADLKEAAKMVSESIDIYNRYRPH"
     gtggctcaat gctgccgtta tctgagtatt acacgacaag cttattacca gcaatgtcag        60
     cgggcagcta taaaagaaaa acaggaacag gaggtgctta ggcgagtaca gtccattcgc       120
     ctgcagcagc cccgtattgg cacaagaaag cttcagtatc tgctgaatca atcaagccca       180
     ttaaaaatag gcagagacag cctattcgat ttactcagaa cccatcgctt actggtcaaa       240
     cccagacggg cttaccacaa aacgacgcag agccatcatc gttttcactg tcaccccaat       300
     ttactcaaag ccggtcccaa taagataacc ccaacggggc cggagcaagt ctgggtggca       360
     gatattacgt atctgcccgt gaaagcagga gaagcgtatt taagtctgat tacggatgcc       420
     tggtcacgta aaatcgtggg gtatcatgtt cacgataact taagcacagg ctcggtcatt       480
     caggcttata aacacgcctt aaaaagtcga aaattgattg aacaatcgct tattcaccat       540
     tcagataggg gattgcaata ttgttcaaaa cactatcaag cgctacatca gcaccatgag       600
     attatctgtt caatgacaga cggttatgat tgctatcagc atgccctggc agagcgagtt       660
     aatggtatcc tgaaaactga atttttactc tgtaaacccg cagacctgaa agaagcggcg       720
     aaaatggtaa gtgagtcgat agatatttat aatcggtata ggcctcactg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page