(data stored in ACNUC7421 zone)

EMBL: FN667743.PE26

FN667743.PE26        Location/Qualifiers
FT   CDS_pept        19229..24751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0026"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92894"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR025429"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92894.1"
FT                   /translation="MGSCNSKRMENAMINFKPKLPALLGALAVLTAGAAHAELLEYTFK
FT                   APDGTQRSLPPNTNYANPTGNVSFALSAGIDRKVKISVLRSDGTVVSTATSHLLGATDR
FT                   ITVGGKSYYGAELQLPAPVAGAYLVRAEILASDGSTVQTDEYPLTVDVTPPTYTSIAPV
FT                   YSNYGQVTSGDIWKLGLGGSEDNAFLLSGISDESPIKGVQAKLYRQDGSLYKDVSVNYD
FT                   DANGQARQSFQSGFFPGSDLDEVFTLQFEISDSAGNIYPSPRQKVMFDSITNAPSSPFG
FT                   VYDPSSTNNLGPGLSGFVAYTAGMAVKTNPIRLAWRVPRDNWHEYREGGIKMVNALGEM
FT                   TKVGEDGNYVYLVTTSPYGNTDGNYWRWVNFGQWGGGGIGYNLTLAPSAPQSPKLLGVD
FT                   YNYSDIGWSTMHRYWVNSSVLPVTVSSIRVKVEPRPYIQTAVHRGSCEIPVGQDNCVIE
FT                   NSFTMTKGTTGYIHDNATVYNSDRSLSSNPMWAEVNWNDQHYPQLSQQYDQSSKVFTLF
FT                   VNQPGRGAYFDRLRLRSAWIEDSKGNKLSPTGGLIANNWENYTYQWDLKTLPEGQYSLV
FT                   AAAEEMHGPLTRQPMFQITSDRTAPTLTISVADGAAIQTLDDVVITLADAVDPSPKLTS
FT                   IALVGGPADDKVQLSWREESKGRFRLEYPVMFPSLKEGESYSLTVAGEDAQGNAVQKAV
FT                   GFEYKPRQVMLADGMDGKVMIPAVTHEFVHADGKRIIETKPLTLSDGAVVTGSYDVFAT
FT                   LRSDAQVPLVVNGVRIEPGQTMGIMSQHDFGASGGRLSIPVKPAVPDEVGSSSLLVMTS
FT                   APNSPILVVDINTWKGAAKLSAESWTIRQVIDPVKIYALPELGVPCRFTTKADVAMAAD
FT                   PIRDPVCLLQWDRTPDEAEQTTQDNNGMKVAGLVGQAVSIGEQPVEYSLYLFSGDGSKV
FT                   KVGSGSQNLTVTTAYDSVGYSPIDDIAQVNRVIEDFDVNFKQSKGPDCSITLSADRAKN
FT                   EAANKGVGSTSRTCLFEWQQIPDGLVQDQLSESPSLSGSLAANGDHPVGWRVSIFTRNG
FT                   TRVTLNDQTFNIEAVDPPAPTVELSSKYNFKDNIYMVPMTGNYLGDAVINSERADLDIA
FT                   ISRNSDVLESETFTPGWGATNKVYRRINTDERALWEETTYKVNAAYNKVPDVKAEVVYR
FT                   AIAAPSDSIRPIVEVQGDTAIDTQALPVRVLIRDQYKPDGDYDANTMGVWKVRLIQQKA
FT                   YNETVALTDYAEASNGEAQFSVDLSGVDTTSVRISAEAVLESPVEGYNRTELSIRPAFL
FT                   TVLRGGAIGAGVDARKLSGEAPFTAVFKLSLDDRQDLRATGQVVWETSKDDGKTWEQFI
FT                   PEDRYKYQLVKTFDKGEYQVRAKVVNVNSGAEKYTEVVSVVAYDKPDIAVVGPTTLFVG
FT                   SEGKYTANLTLNDEPVSGGNAVVEWSTDGGKTYSQTGDSITLSSGEETRYRLWARVRSA
FT                   TAPADDGYAYEIAKTAVDFRAVKAPRPYVTGPRVIETGKKYVFKAETSLPYRGMDVKLN
FT                   GFFTLPNGSIVQGDTAEYEPSDADLNQATVETKYTTWIEGYRDQGAEASHSLRSRVWQY
FT                   VWPSFGMQIRKNADVAPATITASVRPIAFNGKLEEPTYDWELPEGAVIQDKRQDIVRSF
FT                   VINEPGEYNIKVTVRDARGHETVIEQPLKIGQAAPYAIDLQYSGSNKYEREPLDVLLRP
FT                   YISGGHPRDRISTRVYLIDGTPLDGSGYYGRATLGAGEHSIKLKITSEMGHEAEGEVNI
FT                   NVAENKLPACSLSSRETVGSWIVYANCEDTDGRMKSYEWTIAGELQSISSDRVTISKGT
FT                   YEAMPTISLVGVDDSGGKSEAVTMN"
     ttgggttcct gtaactcaaa acgaatggag aatgcgatga tcaattttaa gcctaaactt        60
     ccggcgttgc ttggagctct ggcggttctt accgctggtg ctgctcatgc agagttgctg       120
     gaatatacct ttaaggctcc agatggtact caacggtctc tgcctccgaa taccaactac       180
     gccaacccga cgggcaacgt ttcgtttgcc ttgagtgccg gtatcgaccg caaggtcaag       240
     atttcggtac ttcggtcgga tggaacagtg gtttcgacag cgaccagtca ccttcttggg       300
     gctacagatc gcattacagt aggtggaaaa tcctactatg gtgcggaact tcaactacca       360
     gctccggttg ctggtgcata tctggtcagg gcggaaattc ttgcctctga tggatctaca       420
     gtccagacag atgaataccc tctgactgtc gatgttaccc ctccaaccta cacttcgatt       480
     gcacctgttt acagtaacta tggacaggtc actagcggtg atatttggaa gctgggtcta       540
     ggtggctctg aggataatgc ctttttgctg tctggaattt ctgatgagtc acccatcaaa       600
     ggcgtccaag caaagttgta tcgtcaagac ggttcactct acaaagatgt atcagtgaac       660
     tacgatgacg ctaacggaca agctagacag tctttccaat caggcttttt ccccggctct       720
     gacttggatg aagtgtttac acttcagttt gagataagcg atagtgctgg gaatatctat       780
     ccttcgcctc gtcaaaaagt gatgtttgat agcataacca atgctccgtc atcacctttt       840
     ggtgtttatg acccctccag cacaaataat ttgggtccag gattgtcggg attcgttgct       900
     tatacggctg gaatggctgt taaaaccaac cctatcaggt tggcttggcg agtgccgcga       960
     gacaactggc atgagtaccg agaaggcgga attaagatgg tcaacgcctt aggtgaaatg      1020
     accaaagttg gtgaggatgg taactatgtt tatctcgtca caacatcgcc ttatggaaat      1080
     actgacggca actattggcg ttgggtgaac ttcggccagt ggggtggagg aggcattggt      1140
     tataacctca ctctagctcc atcagcgccc caaagtccca aactcttggg ggtggattac      1200
     aactacagcg acatcgggtg gtcaactatg caccgctact gggtgaacag ttctgttctt      1260
     ccagtcactg ttagcagtat ccgagtcaaa gttgagcctc ggccttacat tcaaactgct      1320
     gttcatcggg gaagttgtga gataccagtt ggtcaagata actgtgtgat tgaaaacagc      1380
     ttcactatga ctaaaggaac aactgggtat atccatgaca atgctacggt ctacaactct      1440
     gacagatctc tgtcttcaaa tcctatgtgg gcagaagtta actggaacga ccagcactac      1500
     cctcagctaa gtcagcaata cgatcaaagc agcaaggtat ttaccttgtt cgttaaccag      1560
     ccaggacgag gcgcttactt tgataggctg cgtctgcgaa gtgcttggat cgaagatagt      1620
     aaaggcaaca agctgtcccc aaccggtggg ttaatagcca acaactggga gaactacacc      1680
     taccagtggg atctaaaaac tctccccgag gggcaataca gtctcgttgc cgcagcagag      1740
     gaaatgcacg ggcctttaac tcggcaaccc atgtttcaga tcacgtccga tagaactgca      1800
     ccaacactga cgatcagtgt ggcagatgga gctgctattc agactctgga cgatgtggtc      1860
     attactttgg ctgatgctgt tgatccttct cctaagctga cctctattgc cctcgtcgga      1920
     ggccctgccg atgacaaggt tcagttgtct tggcgcgaag agtcgaaagg gcgattccgc      1980
     cttgagtacc cggtaatgtt cccgtctttg aaggaagggg aatcttactc gctgactgtg      2040
     gcgggagagg acgcccaagg caacgcggta caaaaggctg ttggcttcga gtacaagcct      2100
     cgtcaggtga tgttggcgga tggtatggat gggaaggtca tgattcctgc tgtcacccat      2160
     gaatttgttc atgcggatgg caaacggatc attgagacta aaccgctgac gctcagtgat      2220
     ggtgctgtcg tgacaggttc atatgacgtg tttgcgactc tccgctctga tgcacaagtg      2280
     ccgctggttg ttaatggtgt tcgcatcgag ccgggccaga caatgggaat catgagccaa      2340
     catgattttg gtgcatcagg tggacgcttg agtatccctg ttaaacctgc tgtacctgat      2400
     gaggtaggct cttccagcct tcttgtcatg acttctgcgc cgaactcacc catcctggtt      2460
     gtagacatca atacttggaa aggtgcagct aaactctctg ctgagtcatg gacaattcgc      2520
     caggttattg atccggtgaa aatctatgcc ttaccagaac tgggagttcc ttgccggttc      2580
     accacgaaag cagatgttgc tatggctgca gacccgattc gtgatccggt atgtttgctc      2640
     cagtgggaca gaactcctga tgaggcggaa caaacgacac aggacaacaa cggcatgaag      2700
     gttgccggac tggtcgggca ggcggtgagc attggtgagc aacctgtcga atacagcctg      2760
     tacctgttca gtggtgatgg ctccaaggtg aaagttggtt caggctctca gaacctgacg      2820
     gtaactacag cctatgattc tgtcggctac tcacctattg atgatattgc tcaggtgaat      2880
     cgcgtcattg aagattttga tgtgaacttc aagcagagca aaggtcctga ttgttctatc      2940
     actctaagcg ctgaccgagc gaaaaacgag gctgcgaaca aaggggtggg gagtacaagc      3000
     cgaacctgtt tgtttgagtg gcagcagatc cctgatggat tggtccaaga ccagttatcg      3060
     gagtcgcctt cgttgtctgg ctcattggct gcgaacggag atcacccagt gggctggcgg      3120
     gtaagtatat tcacccgtaa tggcactcgg gtgacattga acgaccagac gttcaatatc      3180
     gaagctgttg atccaccagc tccgaccgtg gaactgtcct ctaagtacaa cttcaaagac      3240
     aacatttaca tggtgccgat gacaggtaac tacctgggtg atgccgttat caactctgaa      3300
     cgagctgatc tggatattgc catctcgcgc aactctgatg ttttggagtc tgaaacattc      3360
     actcctgggt ggggtgccac caacaaggtg tatcgtcgca tcaacaccga tgagcgagct      3420
     ttgtgggagg agactactta caaggtgaat gctgcgtaca acaaggtgcc tgatgtaaaa      3480
     gcggaggttg tctaccgagc tatagctgca ccttctgata gcatccggcc tatcgttgag      3540
     gttcaaggtg acacggcgat tgatactcag gccttgcctg tccgggtact tatccgtgat      3600
     cagtacaaac ctgacggaga ctatgacgcc aacacgatgg gcgtatggaa agtacgtctg      3660
     atccagcaaa aggcctataa cgagacagta gctctcactg attatgcgga agcatcaaat      3720
     ggtgaagctc agttctcggt ggacctatct ggagtggata caacctctgt ccgtatttcg      3780
     gctgaggctg ttctggaaag ccctgttgag gggtacaacc gaactgagtt gtccattaga      3840
     cccgctttcc tgaccgtact gcgtggtggt gccatcggtg ctggagtaga tgcgcgtaag      3900
     ctgtctggtg aagctccatt cacagcggtg ttcaagttat ctcttgacga ccgtcaggac      3960
     cttcgggcta ccggccaagt tgtctgggaa accagtaagg atgatggcaa aacttgggag      4020
     cagttcatcc cagaagatcg gtacaagtac cagcttgtga agaccttcga caagggtgag      4080
     taccaggtac gagctaaggt ggtgaacgtt aactcgggag ctgagaagta caccgaagta      4140
     gtcagtgtag tcgcttatga caaacctgat attgctgttg tcggcccgac cacgttgttc      4200
     gtggggagtg agggtaagta cacagcaaac ctgacgttga acgatgagcc ggtctctggc      4260
     ggcaatgccg ttgttgagtg gtctactgac ggtggcaaaa cttactcgca gacgggtgat      4320
     agcatcacgc tctcaagtgg tgaagaaacc cgataccgct tgtgggctag ggtgcgctcc      4380
     gccacggcac cggctgatga cggctatgcc tatgagatag cgaagacggc tgttgacttc      4440
     cgagctgtta aagcccctcg tccttatgtg actgggccgc gagtcattga gacaggcaag      4500
     aagtacgtgt tcaaagctga aaccagcctg ccttaccgtg ggatggacgt gaagctgaac      4560
     gggttcttta cactgcctaa tggctcgatt gttcaaggtg ataccgccga gtacgaacct      4620
     tcggacgcgg acctcaacca ggccactgta gaaacgaagt acaccacctg gatcgaagga      4680
     taccgagatc agggtgcaga agcctcacac agcctgcgct cccgcgtgtg gcagtatgtg      4740
     tggccgagct tcggtatgca gatcaggaag aacgctgacg tggctcctgc aacgatcaca      4800
     gcgtcagtgc gaccaattgc cttcaacggc aagctggaag agccgaccta tgactgggag      4860
     ttgccggaag gcgcagttat tcaggacaag cgtcaggata tagtcaggtc ctttgttatc      4920
     aatgagccgg gtgaatacaa catcaaggtg actgtccgtg atgctcgcgg ccatgagacc      4980
     gtgatcgagc aaccgctcaa gataggccag gcagctcctt acgctatcga cctgcaatac      5040
     tctggctcga acaaatacga gcgtgagcct ctggatgtgc tgttgcgacc gtacatttct      5100
     ggcggccacc cacgcgaccg tatttcaact cgtgtctact taatcgacgg aacgccgttg      5160
     gatggcagcg gttactacgg gagagcgact ctgggcgctg gtgagcacag catcaagctg      5220
     aaaataacct ctgagatggg gcatgaagct gagggcgagg tgaacatcaa tgtggcagag      5280
     aataagttac ctgcatgtag cctgagctca agggagactg ttgggtcgtg gatcgtctat      5340
     gcgaactgcg aagataccga tggtcgaatg aagtcctacg agtggaccat tgccggtgag      5400
     ttgcaaagca taagctctga tcgcgtcact atcagcaagg gcacctatga agcgatgccg      5460
     accatctctc tggtcggagt cgatgattct ggtggcaaat ccgaagctgt cacgatgaac      5520
     taa                                                                    5523
//

If you have problems or comments...

PBIL Back to PBIL home page