(data stored in ACNUC7421 zone)

EMBL: FN667743.PE3

FN667743.PE3         Location/Qualifiers
FT   CDS_pept        2158..2436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0003"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92871"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92871.1"
FT                   /translation="MNMKISQDMKRKFALVNALSKTEKPSLQDLHKATNIPESTIKRQL
FT                   AALRDEFGMNILFVRESTGERGATGYYMLTDWGILDRSSFLNRYGKL"
     gtgaatatga agatctcaca ggacatgaag agaaaatttg ctttggtgaa tgccctgtct        60
     aaaacggaga agccaagtct ccaggacctt cacaaggcga caaatattcc tgaatcaaca       120
     atcaagaggc agttggctgc tttgcgtgat gagttcggaa tgaatatctt gttcgtcagg       180
     gaatcaaccg gcgaacgtgg tgccaccggc tactacatgt tgacagattg ggggatctta       240
     gacaggtctt cgttcttgaa ccggtacgga aagctgtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page