(data stored in ACNUC7421 zone)

EMBL: FN667743.PE31

FN667743.PE31        Location/Qualifiers
FT   CDS_pept        28870..30135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0031"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92899"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92899.1"
FT                   /translation="MIKSLAAHIPCSKTVLTVLMLSVAGGGVAQESPLTEQDRELIEQG
FT                   KQIAERTQKMEMPSLLQNQHMDQAQAEAKTFFKQLQSTNQTLKEMQLKQAEKGIYTDHR
FT                   ILVFASLSLGEQGLDDVLTAVSGQPDAVVVFRGIPEGMNLGQGVKAIQALAAKKDPVPN
FT                   IIINPTLFKTYKITAVPTIVMIEDEPLPGEQPNVVAKVSGLSDPVWLAREVDNGEKGDL
FT                   GVRGPVEKIGEADLIDVAKKRLANIDWEDKKKQAAERFWTKQNFNELPRASKARTREID
FT                   PSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRTFTQAVVVFAPLDKKQMELL
FT                   AKKLPEIKREPGVQRITYIATSFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHT
FT                   PSVITSRGKMFVVRELTEEGDE"
     atgatcaaat cattggccgc gcatatcccc tgttctaaga ccgttctaac ggtattgatg        60
     ctttctgtag ctggtggggg agtcgctcaa gaatccccgc ttacagagca ggacagggag       120
     cttattgagc aaggaaaaca gatagccgaa agaactcaga agatggaaat gccgtctttg       180
     ttgcaaaacc aacacatgga ccaggctcag gccgaagcca agacgttttt caagcagctc       240
     cagtctacca atcagacact aaaggaaatg cagctcaagc aggccgagaa aggtatttat       300
     accgaccatc ggatactggt tttcgcctca ctttctcttg gcgagcaggg gctagatgat       360
     gtcttaacgg cagtgtcagg tcagcctgat gctgtggttg tgttccgtgg cattccggaa       420
     gggatgaact tggggcaggg tgtaaaggct attcaggcgc tggcggccaa gaaagaccct       480
     gtgccgaaca tcatcatcaa ccctacattg ttcaaaacat acaaaattac agccgtcccg       540
     acgattgtga tgatcgaaga tgaaccgttg ccgggagagc agccaaatgt tgttgccaaa       600
     gtgtctggtt tgtccgatcc ggtatggctt gctcgtgaag ttgataatgg cgagaagggt       660
     gatcttggtg tcagggggcc agtagagaag attggtgaag ctgatcttat tgatgttgcc       720
     aagaaacgcc ttgccaacat tgactgggaa gataagaaga aacaggctgc tgagcgattt       780
     tggaccaaac agaacttcaa tgagctgccc agagcgtcta aagctcgaac cagagagatt       840
     gaccccagtg tgatgatcac cagtgacatc agcactcctg atggcaccgt gtttgctcat       900
     gccggtgatg tgatcaaccc actgtgcgac ccgaaagaag tttgcaagcc aggaactcgt       960
     acattcaccc aggctgttgt ggttttcgcc ccattagata aaaagcaaat ggagctgctc      1020
     gccaaaaaac tgcctgaaat taagcgggag cctggtgtac agaggatcac ctacatcgct      1080
     acttcgttcg ataaagacaa aggctgggat tcttacaaga gtgtcaccga caactttgat      1140
     gcaccggtat atctactaac tcctgatctg attactcgtt tcgagctgga gcatactccg      1200
     agcgtgatta cctccagagg caagatgttc gtagtccgcg agctgacaga ggagggcgat      1260
     gaatga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page