(data stored in ACNUC7421 zone)

EMBL: FN667743.PE34

FN667743.PE34        Location/Qualifiers
FT   CDS_pept        31911..34727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0034"
FT                   /product="putative mating pair stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92902"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92902.1"
FT                   /translation="MENTMRSHNYFMRAVASLLTVTMSALPIHSYANGSQDQDITAVGK
FT                   EAQAFGQNLSNSFKSSSGTVQDGTISMPTLKDGQFQMNGGSQINVNDLFPGTSGTNNKP
FT                   DSYYFPDANKPDVGGLQGIYESGDDMDSVGNNAKGSLWSDANSANPSISGAAYKVLLDA
FT                   SNRSRPDFSNDPVLNLSKKTYEDMDLIADGFGDCSAETTINQNTINAHIPEYERCQRVV
FT                   DQSADCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGDNYWSGNCTIYEEYTRV
FT                   QVSNPDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWER
FT                   NPNVDVTPYFKNVKDGDVVTFKIRVSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMD
FT                   SAKGVVDGFAEGEITCIDDPTDATGCTVINGIKVCESQLKPSPLPGIPKLCKKVRVKAD
FT                   YDFYKGQMDCWTDPQGETHCPVNTGGNLNSCQKYEENPQCGFISSKCVDGAKGSSGTCY
FT                   VHEDTYDCGTDVSVPTLEKEIEYQCGGPIRCMGDDCLDLTKTQSTDFARATALLNAAQF
FT                   MTQDMSCTGQDGDDNPTGEENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLNL
FT                   IMAVPKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQP
FT                   VEQFIDQLIDQLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTA
FT                   MTIYTVYVVAMVMIQMIYKCEEEEFTMNAKRALKNCSYVGSYCKSKVLGACIEKREAYC
FT                   CFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEGIPLDKIAEIDWSKINLDEWLGILQQNG
FT                   KFPDPNAINLDSLTGAGNDFNVDGTRKNAQERALERLEGIDIDAKRKEATNSIDPQTGA
FT                   PTSGGGGG"
     atggagaaca caatgcgaag tcataattac tttatgagag ctgtggcctc gctgttgaca        60
     gtaaccatgt ctgcgctgcc gatacattcc tatgctaacg gtagccaaga ccaggacatc       120
     acagcggtag gtaaagaggc ccaggctttc ggacaaaacc tctcaaactc attcaagtcg       180
     agctcgggga cagtgcaaga tggcactatc tctatgccga cgctgaaaga tgggcagttc       240
     caaatgaatg gggggagtca gattaatgtc aatgatctat tcccaggaac aagcgggact       300
     aacaataaac cggacagtta ttatttccct gacgccaaca aacctgacgt gggaggcctg       360
     caaggcattt acgagtcagg cgatgacatg gacagcgtgg ggaataatgc caaggggtca       420
     ctctggagtg atgccaatag tgcaaaccca tcaatctcag gggcagcata taaggttctt       480
     ctcgatgcct ctaatcgatc acgccctgat tttagtaatg acccggtact gaacctaagc       540
     aaaaagacct atgaggacat ggacctcatt gccgatggct ttggtgattg ttctgccgaa       600
     acaactatta atcagaatac catcaacgcg catattccag agtatgagcg atgccagcgt       660
     gttgtagatc aaagcgcgga ctgtgaggtt gtccatgact acgacgcctc agttgtgaag       720
     cactatgatg gcccatataa cctcaaatct tgtggagaag gctgtactga gttgtggatt       780
     ggccgagtgg gtgacaacta ctggagtggt aactgtacga tatatgagga gtacacgcgg       840
     gtacaagtca gtaatccaga cgccatagtg tctgcaacgc ttgagtacgc caagtgggat       900
     gactacatgc aagtttgggt aggtaaatcc ggtcaggaaa ctaaagtgtg gtcaggccct       960
     gacggcaact tccctccaga aactgctggt cggtgcgaat tgtcaacaag ttgggagcgt      1020
     aaccctaatg tcgatgtcac cccctatttc aagaatgtga aagatggtga tgttgttacg      1080
     tttaagatcc gcgtttcagt aagtggcgaa ggtgagggtt ttggccgcat aaagctacgc      1140
     tatgacccat caaaagccat taccaaggat gagtgggctc cacagagctg catggattca      1200
     gccaaagggg ttgtagatgg ttttgcggaa ggagagatca cttgtataga tgacccgact      1260
     gatgctacgg gctgcacagt catcaacggg atcaaagttt gcgaatccca actcaaacca      1320
     tcacctttgc ctggtattcc aaagctatgc aaaaaggttc gagttaaagc cgactatgac      1380
     ttctataagg gtcaaatgga ctgctggact gaccctcaag gtgaaacaca ctgtccggta      1440
     aacacgggcg ggaaccttaa tagttgtcag aagtatgaag aaaaccctca gtgcggcttt      1500
     atcagttcca aatgtgttga tggagctaag gggagctctg gaacctgcta cgtccacgag      1560
     gatacctatg actgcggaac ggatgtttct gttccaacct tagaaaagga aatagagtat      1620
     caatgtggtg ggcctatacg ttgtatgggc gacgactgtc ttgatttgac aaaaacacaa      1680
     agtacagatt tcgctcgtgc tactgcattg cttaatgctg cccagtttat gactcaggat      1740
     atgagctgca caggtcaaga cggtgatgac aatccaaccg gggaagaaaa cgttatttgt      1800
     tcagcttttg cgggagaggc tggcgaatgc aaaatagctg ttggaggtgt ttcagattgc      1860
     tgtgaaaagc caaccaatat atctcttgcc gattacttga acctaataat ggctgttcca      1920
     aaacttgatg gggcagtaat gggtttaact gatggtaatg cgcttaaagg ggcttatcag      1980
     gttcttaggg agccagccct tcaagggtgg acagaagtaa caaaaccgtt cacaagttac      2040
     attgagaacg tctctggcgc tgttgattcg ttctttcagc ctgtagagca gtttattgat      2100
     cagctcattg atcagctcaa agagcaagtc aaagaagtga tgatggatgt catgaaatca      2160
     gcaggtcagg atgcagcaac tgagcaagct gctgctgccg cgtccgaaca ggcagccgaa      2220
     gcgatgatgg agacggcaac gacatggctt agtaccgcta tgacgatata taccgtctat      2280
     gttgttgcaa tggtcatgat ccagatgatt tataagtgcg aggaggaaga gttcaccatg      2340
     aacgccaaaa gagcgctaaa aaactgctct tatgtgggtt cttactgtaa atctaaggtg      2400
     ttgggcgctt gtattgaaaa gagagaagca tattgctgct tcaattctcc actctctcgt      2460
     attatacaag aacaagttcg tccgcaattg ggccaaaact ttggggaccc gaaaaacccg      2520
     cagtgtgaag gtattccact agataaaatt gccgaaattg attggagcaa aattaatttg      2580
     gatgagtggc ttgggatatt gcagcagaac ggtaagttcc cagatccaaa cgcaatcaat      2640
     ctcgattcgc tgacaggcgc tggaaacgac tttaatgttg acggtacgcg aaagaatgct      2700
     caggaaaggg cgttagagcg tttagagggg atcgatattg atgcgaagcg taaagaggcg      2760
     acaaatagta tagaccctca aactggagct ccgacaagtg gcggaggagg gggataa         2817
//

If you have problems or comments...

PBIL Back to PBIL home page