(data stored in ACNUC7421 zone)

EMBL: FN667743.PE36

FN667743.PE36        Location/Qualifiers
FT   CDS_pept        complement(35750..36466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0036"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92904"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92904.1"
FT                   /translation="MSGYRLTAFILSSAFICTSNLGVSLMAEAQAAVDTNSDRSNHYSR
FT                   PIFKQALKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEQISKV
FT                   SEDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDKLMGIVD
FT                   TLWLNTVLTSKQRTDATYQWQQRLIKLAGRIIGIEKRARISAHTKGKEGEVAQAAPESE
FT                   TGDKEIADEAEKTKAA"
     atgtcaggtt acagattgac cgcatttatc ctttccagtg cgtttatctg tacctcaaat        60
     ctaggagtat ctctaatggc agaagcacaa gcagcagtgg acacaaacag cgaccgtagc       120
     aaccactact ctcgccctat tttcaaacaa gcattgaaag tgaatagcct ccaggctcag       180
     cgagtcatgg agcggagctt tgagcgagtt tccaactctc tgttctccat cgacgttatc       240
     cttcgtatca tcggtgagca ggatgaaatc gaccaggttg aaaccgtcat cctggaacaa       300
     atttccaagg tctccgaaga tctggacaaa gccaccgccc aactcaacaa actgatggaa       360
     gataacggca tcgacatgat gccgggctat accaacccga acgaatacac catcgagatt       420
     aactctcccc aagttgccca gttcgcgcac ctgatccgta agctggacaa actgatgggg       480
     atcgttgaca cactctggtt aaacaccgtt ctgaccagca agcagcgcac tgacgcgacc       540
     tatcaatggc aacagcgcct catcaaactg gcaggtcgca tcatcggcat cgagaaacga       600
     gctcgtattt ccgcacacac caaaggtaaa gaaggtgaag tggcacaagc agctcctgaa       660
     tctgaaactg gcgacaaaga aatcgcagac gaagccgaaa aaacgaaagc agcataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page