(data stored in ACNUC7421 zone)

EMBL: FN667743.PE39

FN667743.PE39        Location/Qualifiers
FT   CDS_pept        37243..37494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0039"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92907"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92907.1"
FT                   /translation="MACPQSLLVSVCFDDKLQGGCRMQQNLHVYDDHAGIIYLADGREV
FT                   KFDPKLYSSAYLAHSEAVKWAKETGVIGQDDDVVMFVH"
     gtggcttgtc ctcaaagtct tctggtttca gtttgctttg acgacaagct acagggggga        60
     tgtcgaatgc aacagaatct tcatgtttac gacgatcacg caggcatcat ctatctagct       120
     gatggacgcg aggtgaaatt tgatccgaaa ctgtattcca gcgcctatct ggcgcacagc       180
     gaagcagtga aatgggccaa agaaactggg gtcattggtc aagacgacga tgtggtgatg       240
     ttcgtccatt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page