(data stored in ACNUC7421 zone)

EMBL: FN667743.PE45

FN667743.PE45        Location/Qualifiers
FT   CDS_pept        42016..43323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0045"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92913"
FT                   /db_xref="InterPro:IPR021496"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92913.1"
FT                   /translation="MVRPQLLECIMTKVNHLQSLCVIHVDFDIWSGQTRLSASDLKLGE
FT                   GGEIPPEKVAQLGSKKICDPAKLKGFHRLKTETRRLLLKFGMPFMNGFAVPVSRTDEIC
FT                   NKLNDINYQFNQLKQDFINGYNKAVDEWCQENPEYERAIRAGVLPKETVEERIGFEYQV
FT                   FMIQPVNEDEANAKRLNRKVERLGDDLVSEVVQEANKFYMERLAGRDQCAVTTRQTLRN
FT                   IRDKVDGLSFLNSAFNPLVKLLDQTLRGYEQHADGRNIVAPFFYQVVAAVLIMSERERI
FT                   EEYANGSITVEGMALNIGGSEAHMGDRSKNEKAGLESDKAGESTLVLKGDNTVQQQVGG
FT                   AGAVQSEQTNNGGDAVDLDEDIDSFFKNFAERGEGESEDDPNAGDAVQDEYVDVEDEPV
FT                   LPEETLVEPEPIQEEPATEPLNQEPPKTDDDGDFFF"
     gtggtgcgcc cccaactttt ggagtgcatc atgactaaag tgaaccatct acaaagcctt        60
     tgtgttatcc acgttgactt tgacatttgg agcggacaaa cacgtttgtc tgcatctgac       120
     ctaaagctgg gtgagggtgg tgaaatacca cctgagaaag tcgctcaact aggaagtaaa       180
     aaaatctgtg atccggcgaa gctgaaaggc tttcatcgcc tgaaaacaga aactcgtcgt       240
     ctcctgctga aattcggtat gccgtttatg aacggatttg ccgtccctgt cagcaggacc       300
     gatgaaatct gtaacaagct gaatgacatc aactaccagt tcaaccaatt gaaacaggat       360
     ttcatcaacg gttataacaa agctgtggat gaatggtgtc aggaaaaccc tgaatacgaa       420
     cgagccatac gcgctggagt ccttccaaag gaaacggtcg aagagcggat tggttttgaa       480
     tatcaggtgt tcatgattca gccggtgaac gaggatgagg ctaacgctaa gcgccttaac       540
     cgcaaggttg agcgtctggg tgacgatctt gtctccgaag tagttcagga agcaaataag       600
     ttctatatgg aacgtttggc aggtcgagac caatgtgcgg ttacgacacg acaaaccctc       660
     cgtaatatcc gcgataaagt ggatgggctt agcttcttga acagcgcttt taaccctttg       720
     gtcaagctgc tcgatcagac ccttcgtggc tacgagcaac atgctgatgg tcgtaacatc       780
     gttgcacctt tcttttatca ggtcgtggcc gcagtgctga tcatgagcga aagggaacgc       840
     atcgaagagt atgccaacgg ttcgatcact gtagagggaa tggctcttaa cattggcggt       900
     tcggaagccc atatggggga ccgttctaaa aatgaaaaag ccggactgga aagcgataaa       960
     gctggtgagt ctaccctcgt actaaagggt gacaacactg tgcagcaaca ggtaggtggt      1020
     gctggcgctg ttcaatctga acagaccaac aacggtggtg acgccgttga cctggatgaa      1080
     gacattgaca gcttcttcaa gaattttgca gaacgaggtg agggcgagtc ggaagatgac      1140
     cccaatgccg gtgatgctgt tcaagatgaa tacgttgatg ttgaggatga gcctgtttta      1200
     cctgaggaaa ctctggtaga acccgaaccc atccaagagg agcctgctac ggagcctctc      1260
     aaccaggaac cgcctaaaac tgacgatgat ggtgactttt tcttttaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page