(data stored in ACNUC7421 zone)

EMBL: FN667743.PE51

FN667743.PE51        Location/Qualifiers
FT   CDS_pept        48056..48244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92919"
FT                   /db_xref="GOA:D3VLW7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92919.1"
FT                   /translation="MEQIENKGLTVETHCRSGFCGMCRVRLLKGQVAYDETPVAFVKEG
FT                   EVLVCCAKAKTDVTLEI"
     ttggaacaaa tcgagaacaa aggcctcact gttgaaacgc attgtcgcag tggcttttgt        60
     ggcatgtgcc gggttcgtct tctcaaaggt caagtggcct atgacgagac ccccgtcgca       120
     tttgtcaaag aaggggaagt gttggtttgc tgcgctaaag caaaaactga tgtgaccttg       180
     gaaatttaa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page