(data stored in ACNUC7421 zone)

EMBL: FN667743.PE60

FN667743.PE60        Location/Qualifiers
FT   CDS_pept        53335..53721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0060"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92928"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92928.1"
FT                   /translation="MSKNVNDVFSNRTSLECTVNAALDRRIGLRVGFPHYREGANGVVC
FT                   EIEAEYPLLNTHSSVAWPLIDELNSYTIQKNQSLIDHIDNAVAELLKHKTRLQLDIQKL
FT                   QDGDINLVKQAKQQYDDNQMSSTS"
     atgtctaaaa acgtcaacga tgttttttca aaccgaactt ctttggaatg tactgtgaat        60
     gcagcgctgg atcgtcgtat cggtctgcgt gtcgggttcc ctcattaccg agaaggagca       120
     aacggtgtgg tttgtgagat tgaagcagag tatccattgc tgaacactca ttcgagtgtt       180
     gcatggcctc tgatcgatga gctcaacagt tacaccattc aaaaaaacca atcgctcatt       240
     gatcacattg ataatgcggt cgctgaactg ttgaaacaca agactcgtct acagcttgat       300
     attcaaaagc tgcaagacgg tgacattaat ctggtgaaac aggccaagca gcaatacgac       360
     gacaatcaaa tgtcgagtac cagctag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page