(data stored in ACNUC7421 zone)

EMBL: FN667743.PE61

FN667743.PE61        Location/Qualifiers
FT   CDS_pept        53756..56122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92929"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92929.1"
FT                   /translation="MGCFPGRDGHPANPGGPMQQALNFDLSEQPLPVLLRGDKWDSVWS
FT                   ELTDNEDLNFVDASRGTSLSSLITSSVEAIHTALIDGWTMMIGYSSGKDSETVLHLFLM
FT                   ALIRAVRSGATISQHHFILHTDTLIESPEVRWLADQKLAELERFIAKENLPLTIVLAKP
FT                   GISQSWTGRILTGRGLPTFSNSTARQCSQDLKITSAKRAKAAYMRELPKEVRQKVCLLL
FT                   GSRDAESTIRAASIAKQRGSSDRVIKTKDGGELYVVKNWLASDVWEFLLSAGMGSTYPL
FT                   PSYLESNVTTAELYKAATGECVWSATEKKASDACGARFGCWACQAVGLDKSMETLLATD
FT                   PERHGYMSGLNRIQRYLAKRRYAWEDRHPVGRTIYEGGYIKIQPDVYSPVFLERLLHVC
FT                   CSMDYMEQKRADELAYKLATGQTEDNDWNRRMAEPQFRIISEEALVHIDFMWAFHHFND
FT                   KPFHALEIYHRVWSMGDLDLLEDEPQCETVPQSPIPKPLWLKVGRWGDGSLSDGLADPL
FT                   AEMAYFDGGDDPLAAKVINTADGKRRVVCFAEDDEVKVDPDSAAFIIWNEYPRLRESVL
FT                   KGHYTPGSAAQFYLRFGAIQLAKGKGALYHRMMQRGQTYHQMGLTGLQTMEGIQQRKDV
FT                   KVLSDAKYKDLVRRKIKGRLATVRWWVNLHLTFKYHLHHRTPTGLFIEKQLNQEAMEEQ
FT                   KRHQARWFNYVTDAMLCYSSAFCMSVMEGREGSGNTNIRRYMIATRRKAYTALCELLNN
FT                   TDAPWVSDVLQGALGQYESIQAALTEGSALTIYTQ"
     ttggggtgct ttcccggaag ggatgggcac cctgctaatc caggaggccc tatgcaacaa        60
     gcattaaact ttgatctttc agaacaaccc ctcccagtgc ttttgcgcgg ggataagtgg       120
     gattctgttt ggtcagaact gactgacaac gaggatttga acttcgttga tgccagtaga       180
     ggaaccagtt tgtcatcgtt gatcacgtca tcggttgaag ccattcacac ggccttgatt       240
     gatgggtgga ccatgatgat cggctattcc agtggtaaag attctgaaac ggtcttgcat       300
     ctgttcctga tggccctgat ccgggctgtt aggagtggag cgaccatcag ccagcaccac       360
     ttcatcttgc acactgacac actgatcgaa agcccagagg taaggtggct ggcggatcag       420
     aaactggccg agctggagcg tttcattgcg aaggaaaacc ttcctctgac catcgttctg       480
     gcaaagcctg ggatctcgca gagttggacg ggccgaatcc ttactgggag ggggttgcct       540
     acgttttcca actccacggc ccgtcagtgt agccaggatc taaaaatcac ctcggccaaa       600
     agagcgaagg cagcttatat gcgagagctt cccaaagagg ttcggcagaa agtgtgcctt       660
     ttgctgggta gtcgtgatgc tgaaagcact attcgtgcag ccagcattgc aaaacagcga       720
     ggaagctcag atcgcgtcat taagacgaaa gatgggggtg agctgtatgt ggtgaaaaac       780
     tggttggcga gtgatgtatg ggagttcttg ttatccgctg gcatgggttc aacatatcct       840
     ctgccaagtt acttggagag caatgtcact acggcagagc tctacaaggc ggcaacagga       900
     gagtgcgtgt ggtcggcaac agagaaaaag gccagtgacg cctgtggcgc tcgcttcggt       960
     tgctgggctt gccaggctgt tgggttggat aagtcaatgg agacattgct tgccacggac      1020
     cctgaaaggc atggctacat gtcagggctg aaccgcatcc agcgctactt ggctaagcgc      1080
     cggtacgcat gggaagaccg ccatcccgta ggtcgaacga tttatgaggg tggttacatc      1140
     aaaatacagc cggacgttta cagtcctgtt ttccttgagc gattgcttca tgtctgttgc      1200
     agcatggact acatggagca aaagagagct gatgagctgg cttataagct ggctactggg      1260
     caaacagagg ataacgactg gaaccgtcga atggcagagc cacaattccg gatcatatcg      1320
     gaagaggctt tagtccatat cgacttcatg tgggccttcc atcatttcaa tgataagcct      1380
     ttccatgctc tggagattta ccacagggtt tggtcgatgg gtgatctgga cttgttggaa      1440
     gacgagccgc agtgtgaaac cgttcctcag tcaccaattc cgaagccatt gtggttgaag      1500
     gttggccgct ggggcgatgg ttcgctttct gatggcttgg ccgatccgtt agctgaaatg      1560
     gcttactttg acggcgggga tgacccgttg gcagcgaaag tgatcaatac cgcagacgga      1620
     aagagaaggg tggtttgttt cgcagaagat gatgaggtga aagtcgatcc tgactccgct      1680
     gcgttcatca tctggaacga atacccgaga ctaagggagt cagttctaaa ggggcattac      1740
     acccccggca gcgctgctca gttttacctt aggtttggag caatccagct tgcgaaagga      1800
     aaaggcgctt tgtatcaccg catgatgcaa agaggtcaaa cctaccacca gatgggcctt      1860
     acagggctac agacgatgga aggaatccaa caacgcaagg atgtcaaagt gcttagcgat      1920
     gccaagtaca aagatctggt gaggcgaaag atcaaaggaa gactggcaac tgtacgctgg      1980
     tgggtaaact tgcacttaac gttcaagtac cacctgcatc accggactcc gacaggtttg      2040
     ttcatcgaga agcaactcaa ccaggaagca atggaagaac agaagcggca tcaggcacga      2100
     tggtttaact acgtgaccga tgcaatgcta tgttactcca gtgcattctg tatgagcgtc      2160
     atggaagggc gagaaggaag cggaaacact aacatccgcc gttacatgat agcgaccaga      2220
     agaaaggctt atacggcgct ctgtgagctc ctaaacaata ctgatgcacc ttgggtgtct      2280
     gatgtattgc agggggcatt ggggcagtat gagtcgatac aggcagcctt aaccgaaggt      2340
     tcagcgctga ctatttatac gcaataa                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page