(data stored in ACNUC7421 zone)

EMBL: FN667743.PE64

FN667743.PE64        Location/Qualifiers
FT   CDS_pept        57439..57705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0064"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92932"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92932.1"
FT                   /translation="MTNLQPGDIKIKDFGRDRKFRSVDELQSTLSEQYKGQHVSIVYPG
FT                   KPNGLLRTVFVSVDDAGGVNQSYGDQSPVDFSAIKDDLFGEML"
     atgactaacc tacaacctgg cgacatcaag attaaagact ttggccgcga ccggaaattc        60
     cgttcggttg atgagcttca aagcactttg tctgaacagt acaaaggtca gcatgtcagt       120
     atcgtttacc caggaaagcc taacgggttg ctccgaacgg tctttgtcag tgttgatgat       180
     gctggtggcg taaatcagtc ctatggagac caatctccag tcgatttttc tgccatcaaa       240
     gatgaccttt ttggtgaaat gctatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page