(data stored in ACNUC7421 zone)
EMBL: FN667743.PE64
FN667743.PE64 Location/Qualifiers
FT CDS_pept 57439..57705
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="XNC1_p0064"
FT /product="hypothetical protein"
FT /note="Evidence 5 : No homology to any previously reported
FT sequences"
FT /db_xref="EnsemblGenomes-Gn:XNC1_p0064"
FT /db_xref="EnsemblGenomes-Tr:CBJ92932"
FT /db_xref="UniProtKB/TrEMBL:D3VLY0"
FT /inference="ab initio prediction:AMIGene:2.0"
FT /protein_id="CBJ92932.1"
FT /translation="MTNLQPGDIKIKDFGRDRKFRSVDELQSTLSEQYKGQHVSIVYPG
FT KPNGLLRTVFVSVDDAGGVNQSYGDQSPVDFSAIKDDLFGEML"
atgactaacc tacaacctgg cgacatcaag attaaagact ttggccgcga ccggaaattc 60
cgttcggttg atgagcttca aagcactttg tctgaacagt acaaaggtca gcatgtcagt 120
atcgtttacc caggaaagcc taacgggttg ctccgaacgg tctttgtcag tgttgatgat 180
gctggtggcg taaatcagtc ctatggagac caatctccag tcgatttttc tgccatcaaa 240
gatgaccttt ttggtgaaat gctatga 267
//
If you have problems or comments...
Back to PBIL home page