(data stored in ACNUC7421 zone)

EMBL: FN667743.PE66

FN667743.PE66        Location/Qualifiers
FT   CDS_pept        57954..58541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0066"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92934"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92934.1"
FT                   /translation="MVRPNYKECTMSNFEQALERTDGKTLILSNGSKWAGQDPDNIQTL
FT                   LDVLGNNVLDPMFEQYHCYRSYPFEPLIKTGRNDKIFQPWLGAACFFGNFLTVSHVFNI
FT                   ITKDDSVVEALNEAIQKNIATEQYQQYAYERYAGWFYAETSEGFRLVSPSEAADIRAGA
FT                   VSKLRYPRNFEVMKTAVIKGPRFDAELSRKAS"
     gtggtgcgtc ctaactataa ggaatgcact atgtctaact ttgaacaagc tctggaacgt        60
     actgacggca agacactgat tctcagcaac gggagtaagt gggcaggcca agatccggat       120
     aacattcaga ctttgctgga tgttctcggc aacaacgttc ttgatccaat gtttgagcag       180
     tatcactgct accgttctta tccgtttgaa cccctgatta agacagggcg caatgataag       240
     atattccagc cttggctggg agcagcttgt ttctttggga actttcttac ggtctctcat       300
     gttttcaaca tcatcacgaa agatgacagt gttgttgagg cgttaaatga ggcgatccag       360
     aagaacatag cgactgaaca ataccagcag tatgcctatg agcgttacgc cggttggttc       420
     tacgctgaaa ctagcgaagg gtttaggctt gtatctccaa gtgaggctgc cgacatccgt       480
     gcaggcgcag tttcaaagct gcgttaccca agaaacttcg aggttatgaa aactgcggtt       540
     atcaaaggcc ctcgattcga tgctgaatta agccgcaagg cttcttaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page