(data stored in ACNUC7421 zone)

EMBL: FN667743.PE69

FN667743.PE69        Location/Qualifiers
FT   CDS_pept        59931..60317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0069"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92937"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92937.1"
FT                   /translation="MNQLAKLDIAQIRQQAINDGLLVDQSSIGKQAGFLTNVAVTPAIV
FT                   DGVFGADGKHSVEDFLLMFLQLCVAQTKVAFTDNKNWGKIRLYYPMPTVEGFFKPTEVV
FT                   IKSDPVTADVTVMMASEEGTHLCL"
     atgaaccaat tagctaaatt ggacatcgcc caaatccgtc aacaagccat caatgatgga        60
     ctgctggtgg accaatcttc catcggtaag caagctggtt ttctgacgaa tgtggcagtg       120
     accccggcaa ttgtcgatgg tgtatttggt gcagatggta aacactcagt agaagacttc       180
     cttctcatgt ttttgcagct ttgtgttgct caaacaaagg tcgcttttac tgacaacaag       240
     aactggggaa agattcgtct ttactacccc atgcctactg tagaaggctt tttcaaaccc       300
     actgaggttg tgattaagtc agatcctgta accgcagatg tcacagtcat gatggcctcg       360
     gaagagggta ctcatttgtg cttgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page