(data stored in ACNUC7421 zone)

EMBL: FN667743.PE70

FN667743.PE70        Location/Qualifiers
FT   CDS_pept        60398..62221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0070"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92938"
FT                   /db_xref="GOA:D3VLY6"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92938.1"
FT                   /translation="MAHPPSVGVSLKPWPRGVKEASMLGFTLRRKPMSYYKADTVREAA
FT                   NGNWLFILAALAPHLEPALRKPGRHVSCPIHGGKDGFRLFKDAHLTGGGVCNTCGANHD
FT                   GFELLMWLNNWDFKQCLSEVGDYLGVEKEQPQYQQSAAPSRAPAQAKAPVQQEPMKVNN
FT                   KVLDSKNRKKSIAGTLIAHGKAPYEHNEDNELSYFAFIRDKSGLERTVWGVDLERAIGE
FT                   SEAKYGDEIIMTNLGREPVTVVVEVKDDQGNVVREQPMQTHRNTWLVERRGATVTQFRA
FT                   RSNGGVEPVSHYVESAPVVNHTVDTPAPQAHAAATQPEAQSSEDKPKVVPMFREQPKPW
FT                   LLELQEEMEKRMERERAYSARLREKIEKVWNECLPFSSHVTEPMRLYFKNRELLFKVDE
FT                   VEKTDCLRFNPAMAYYDEDGNEVGKFPAIVCAIRDVEGNLVTLHRTYLTPNGKKAKVGN
FT                   AKKMMPIPEGLDVNGAAIRLGEPTEGILGVAEGLETALSAYRVTQIPVWSTVNATLMES
FT                   FEVPEGVHTVLIWADKDKSVTGEKSANVLKAKLEKRGIRVYILLPKLPIPPRAKGIDWN
FT                   DVLMSQGSLGFPNARYLRDFIARRRDEYARH"
     ttggcacatc ctcccagtgt cggggtttcc ttaaaaccct ggccacgggg ggttaaggaa        60
     gcctcgatgc tggggttcac gctaaggaga aaacctatgt cttactacaa agctgacacc       120
     gttcgtgaag cggctaacgg aaactggcta ttcatcctgg cggccctagc gccccatctt       180
     gaaccagctc tccgtaaacc aggtcgtcat gtttcttgcc ctatccacgg cgggaaagat       240
     ggcttccgac tgttcaaaga tgcccacctg actggtggcg gcgtatgcaa cacatgcggt       300
     gctaatcatg atggttttga gttgctcatg tggctcaaca actgggactt taagcagtgc       360
     ctaagcgagg ttggtgatta cctgggagtt gagaaagagc agccccagta tcaacaatct       420
     gctgcaccgt cacgagctcc tgctcaggcc aaagcgcctg ttcagcaaga gcccatgaag       480
     gtgaacaaca aggttctcga ttccaagaat cgtaagaaat ccattgccgg tactctgatc       540
     gcccacggaa aagctcccta cgagcataat gaagacaatg agcttagcta ctttgccttc       600
     atccgtgaca agagtggctt ggaacgcacc gtttggggcg tggatcttga aagagccatt       660
     ggtgaaagcg aagccaagta tggggatgag atcatcatga caaacctcgg gcgcgaacct       720
     gtaactgtcg tcgttgaagt taaagacgat caggggaatg ttgtgagaga acaacctatg       780
     caaacgcacc gcaacacttg gttggtcgaa cgtcgtggcg ctacggtaac gcagttccgc       840
     gctcgttcaa acggtggtgt tgaaccggtg agtcactatg ttgagtcggc ccctgtggtc       900
     aaccacacgg tagacactcc ggcaccgcaa gcacacgctg cggccacaca accggaagcg       960
     caaagcagcg aagacaagcc gaaagttgtt ccgatgtttc gtgaacaacc caagccttgg      1020
     ctgcttgagc tccaagagga aatggagaag agaatggagc gcgaacgcgc ttacagtgct      1080
     cgtctccgtg agaaaatcga gaaggtatgg aacgagtgtt taccgttctc cagtcatgtg      1140
     actgagccaa tgcgtctgta cttcaaaaac cgtgaacttc tgttcaaggt cgatgaagta      1200
     gaaaaaacag actgtctgcg gttcaatccg gctatggcct actacgacga agatggcaat      1260
     gaagttggga aattcccggc tatcgtctgc gctatccgag atgtggaagg caacctggta      1320
     acgctccacc gcacctatct caccccaaac ggtaagaaag ctaaggtcgg caacgccaag      1380
     aaaatgatgc ccattccgga aggtttggat gtcaatggcg cggccatccg ccttggtgaa      1440
     ccgactgagg gtatcctggg tgttgcagaa gggttggaaa cagctctatc cgcttatcga      1500
     gtcactcaaa tcccggtttg gtcaacggtt aatgcgaccc tgatggagtc ctttgaggtt      1560
     ccggaaggtg ttcacaccgt actgatctgg gctgacaaag ataagtctgt gactggtgag      1620
     aagtcagcga atgtgctgaa agccaagctg gagaagcgcg gcattcgtgt gtacatcctg      1680
     ctgcctaagc tccctatccc gcccagagcg aaagggattg actggaacga tgtcctgatg      1740
     agtcagggaa gccttggttt cccgaatgct cgctacctgc gcgattttat tgcgagaagg      1800
     agagatgagt atgcccgtca ttga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page