(data stored in ACNUC7421 zone)

EMBL: FN667743.PE73

FN667743.PE73        Location/Qualifiers
FT   CDS_pept        complement(63057..64457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0073"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92941"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92941.1"
FT                   /translation="MQLTIQIATVDKSGHRHTEKLLAIEKQTDSPNDIGLSLSESKQLL
FT                   NTVQQSVIQKQAAEFLDEHRPCPCCQRNRRIKGRQKIQYRTLFGIIPVEGFRVYRCICE
FT                   KNSPQTVNLLNDWCSEYTHPELKYIETKWASLMAYGLTASLLKDILPVGERCNAATIRN
FT                   HLCQTAKRQEAELDGLPDFLSGSPREWAKLPKPGKPMTVGIDGGYVRNRDDKKHHFEII
FT                   AGKSFSADVPAKRFGFVQCLENHPRRKLLAQLSSQGMQANQQITFLSDGADNLRELQFN
FT                   LYPESQHILDWFHITMRLTVLKQYSKGVSKNDPELGTELLDSLTRTKWYIWHGNVIKAL
FT                   EHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMYRYGEAISSSFV
FT                   ESTINEVIAKRMVKKQQMQWSQQGAHYLLQTRTAVLNGDLKTQFEHWYPGIKLGDKTDH
FT                   YWTEAVAA"
     atgcaactca cgatccaaat cgcgacggtt gataaatcag gtcatcgtca tacggagaaa        60
     ttactcgcga tagaaaaaca gactgattct cccaatgaca taggcctttc cctgtctgaa       120
     tctaaacagc ttttgaacac agtccagcaa tcagtgatcc agaaacaggc ggctgaattt       180
     ctggatgaac atcgtccctg cccttgctgt cagcgaaacc gccggataaa aggaagacaa       240
     aaaatccagt atcgaacctt atttggcatt attcctgtcg agggatttcg ggtttaccgg       300
     tgtatttgtg agaagaattc accccaaaca gtgaatctgc tcaatgactg gtgtagtgaa       360
     tatactcatc ccgaactcaa gtatatagaa accaaatggg catcattgat ggcctatgga       420
     ctgaccgcca gtctgcttaa agatattctg ccggtgggag aacgctgtaa tgccgccacc       480
     atccgaaatc acctttgtca aaccgccaaa agacaagagg cagagttaga tgggctgcct       540
     gattttctct ctggctcccc cagagaatgg gcaaaattac ccaaaccggg gaaaccgatg       600
     acagtgggta ttgatggagg ttatgtcaga aatcgggacg ataaaaaaca tcatttcgaa       660
     atcatcgccg gaaaatcttt ctctgctgat gtccccgcta aacgtttcgg atttgtgcaa       720
     tgtctggaaa atcaccccag aagaaaactg cttgctcaat tatcttcaca gggaatgcag       780
     gctaatcaac aaattacctt tttatctgat ggagccgata atcttcggga actgcaattt       840
     aacctgtacc ccgaatccca gcacatactt gattggtttc atattacaat gcgtctgacc       900
     gtactaaaac aatattccaa aggggtatct aaaaatgatc cggagcttgg tacagaatta       960
     ttagattctt taacccgtac aaaatggtat atctggcatg gaaatgtgat taaggcatta      1020
     gaacacctgg atgattgtgc ggcaatgtgt gatgaggaca tatcgcatta tggtaataat      1080
     aaatcattgt taaaacatat agatgaaatg tatacctata ttgaaaataa cagcatgatg      1140
     atcccgaatt acggtgaaat gtaccgatat ggtgaagcaa tttcctcttc atttgttgaa      1200
     tcgacgatca atgaagttat cgctaaacgg atggtgaaaa agcagcagat gcaatggagc      1260
     cagcaaggtg cacattactt actccagaca cgcacagcgg tactcaatgg tgatttaaaa      1320
     acccaatttg agcactggta tccgggtata aaattaggtg acaaaacgga tcattattgg      1380
     acagaggcag ttgctgcata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page