(data stored in ACNUC7421 zone)

EMBL: FN667743.PE74

FN667743.PE74        Location/Qualifiers
FT   CDS_pept        complement(64586..65254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92942"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92942.1"
FT                   /translation="MQHIFIGHQFMQIYIVKVALRNVSPMVWRRFRLSGKTSLAAFHYI
FT                   IQIAQGWHDDHLHQFRIYGKDYGISYSGGIAFPDNPYKVTLDDLEFDAGDRFTYEYNFF
FT                   ENWLHDIRIETILDNSNLKSPFCLAGNRMPGATLADETTKTLALLNAIIHADETTTVGE
FT                   IRPLIEALDTVRFNRLKVNRQLSRLNLDSPELEPIVINCAENALADRLRISVNSLRLTR
FT                   "
     atgcaacata tttttatcgg gcatcaattc atgcaaatct atattgtgaa agtggctctt        60
     cggaacgtta gccctatggt ttggcggcgg ttcagactct caggaaagac ctctttagcg       120
     gcttttcact atatcattca gattgctcaa ggatggcatg acgaccatct tcaccaattc       180
     cgtatttatg gcaaagatta tggtatttcc tattctggcg gaattgcgtt tcctgataac       240
     ccttacaaag tcacgctcga tgaccttgaa tttgatgccg gtgatcgttt tacttacgaa       300
     tacaattttt tcgaaaactg gcttcacgat atccgtattg aaactattct cgataattct       360
     aacctgaaat cacctttttg tctggccgga aaccgaatgc ccggggcgac gttagccgat       420
     gaaacgacta aaacactggc attgctcaac gcgattattc atgctgatga aacgaccacg       480
     gtcggagaaa tccgtccctt gattgaggct cttgataccg tcagattcaa tcgtctaaag       540
     gttaaccgcc aattaagtcg gctcaatctt gattcaccgg aacttgaacc catcgtgata       600
     aactgcgcgg agaacgcact ggccgaccgc ctgcggatat cagtaaactc cctcagattg       660
     acgcgctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page