(data stored in ACNUC7421 zone)
EMBL: FN667743.PE76
FN667743.PE76 Location/Qualifiers
FT CDS_pept complement(65586..65789)
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="XNC1_p0076"
FT /product="hypothetical protein"
FT /note="Evidence 5 : No homology to any previously reported
FT sequences"
FT /db_xref="EnsemblGenomes-Gn:XNC1_p0076"
FT /db_xref="EnsemblGenomes-Tr:CBJ92944"
FT /db_xref="UniProtKB/TrEMBL:D3VLZ2"
FT /inference="ab initio prediction:AMIGene:2.0"
FT /protein_id="CBJ92944.1"
FT /translation="MLRMPPPQTFPPETLSLDDLVPQNHLVRKVDAALDFEFIRNLVAP
FT LYCHNNAINLFENNGVCQRFGL"
atgttaagaa tgccccctcc ccaaactttt ccgcccgaaa cgctctcact tgatgacctt 60
gtgccccaaa atcatctggt tcgcaaagtc gatgctgcct tggatttcga atttatccgt 120
aacttagtcg ccccgttgta ttgccacaat aatgcgataa acctctttga aaataacggg 180
gtttgtcagc ggtttgggtt ataa 204
//
If you have problems or comments...
Back to PBIL home page