(data stored in ACNUC7421 zone)

EMBL: FN667743.PE76

FN667743.PE76        Location/Qualifiers
FT   CDS_pept        complement(65586..65789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0076"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92944"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92944.1"
FT                   /translation="MLRMPPPQTFPPETLSLDDLVPQNHLVRKVDAALDFEFIRNLVAP
FT                   LYCHNNAINLFENNGVCQRFGL"
     atgttaagaa tgccccctcc ccaaactttt ccgcccgaaa cgctctcact tgatgacctt        60
     gtgccccaaa atcatctggt tcgcaaagtc gatgctgcct tggatttcga atttatccgt       120
     aacttagtcg ccccgttgta ttgccacaat aatgcgataa acctctttga aaataacggg       180
     gtttgtcagc ggtttgggtt ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page