(data stored in ACNUC7421 zone)

EMBL: FN667743.PE8

FN667743.PE8         Location/Qualifiers
FT   CDS_pept        4207..4488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0008"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92876"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92876.1"
FT                   /translation="MNHATASPMSRVPIFVRAMQRGALSVYTKDKNNAYSLSAAGKAFV
FT                   SQLHKKTFDPDLPFRINDWLNRGDYDAMSRYIRTVFGRQIRFQRNLGN"
     ttgaaccatg cgactgcgtc tcccatgtct agagttccta tattcgtgag agcaatgcag        60
     cgcggagcat tgtctgtgta taccaaagat aaaaataatg cgtattctct gtctgctgcc       120
     gggaaagcgt ttgtttctca gctccacaaa aagacgtttg atccagactt gccattccga       180
     attaatgact ggttaaatag aggtgattat gatgcgatgt ctcgatatat aagaacggta       240
     tttggcaggc aaattaggtt tcaaagaaat ttaggcaatt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page