(data stored in ACNUC7421 zone)

EMBL: FN667743.PE85

FN667743.PE85        Location/Qualifiers
FT   CDS_pept        complement(74704..74970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0085"
FT                   /product="putative regulator with homeodomain-like DNA
FT                   binding domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92953"
FT                   /db_xref="GOA:D3VM01"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92953.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVMGFGEQRNSKHR"
     atgctttata ctagcaatcc catcatcaaa cacaaggcgg gtctgcttaa tctcgctgaa        60
     gaactcagta atgtctcgag agcctgtaaa gtgatgggcg tatccagaga tacgttttat       120
     cgttatcagg aactcgttga aacgggcggg attgatgcat taatcaacca aagcagaaaa       180
     acccctaatc tgaagaaccg tgtggatgcg gagaccgaac acgccgttat ggggtttggg       240
     gagcaacgga acagtaaaca ccgttaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page