(data stored in ACNUC7421 zone)

EMBL: FN667743.PE9

FN667743.PE9         Location/Qualifiers
FT   CDS_pept        complement(4516..4920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0009"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92877"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92877.1"
FT                   /translation="MFGSIILATILTTSSAITEDTGEGISSGIMAASASYLAQNIMPLT
FT                   SGLKSNHSYRTTEAVDMAKALGGLKDLPEFIYVITDVNAHMADMCNRIWEPQSLALTPF
FT                   IVEMVELRKANENSAYENVLSELNCSHLED"
     atgttcggat caatcatcct agctaccata ctaaccacaa gttcagccat taccgaagat        60
     acaggtgaag gtatttcatc tggaataatg gcggcgtcag caagctattt agcacaaaac       120
     ataatgcctc tcacttctgg acttaaaagt aatcatagct accggaccac ggaagcagtt       180
     gatatggcaa aggctttggg aggtctaaaa gatcttcctg aatttattta cgtcattact       240
     gatgtaaatg cccacatggc cgatatgtgt aatcgcatct gggagccaca atctttggct       300
     ctaaccccat tcattgtaga gatggtagaa ctgcggaaag caaatgaaaa tagcgcctac       360
     gaaaatgtgc tatccgaact caactgctcg catttagaag attaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page