(data stored in ACNUC7421 zone)

EMBL: FN667743.PE97

FN667743.PE97        Location/Qualifiers
FT   CDS_pept        85243..86118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92965"
FT                   /db_xref="GOA:D3VM13"
FT                   /db_xref="InterPro:IPR008865"
FT                   /db_xref="InterPro:IPR036381"
FT                   /db_xref="InterPro:IPR036384"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92965.1"
FT                   /translation="MAKNFISEQFSAMCRDLTNLSSIIKRLPPRYAKVAAIPPTRKGME
FT                   NERINNIVVTEQIGREALELAAHSYKDLHINPDYSQKSARRTVGVLWFSPSKVGLAAKI
FT                   AATVDRINAAKAGIEEFIISTYPSRQERFEALRVDCPGVMTLHLYRQIRCYSSGDIDSI
FT                   RFTWQRKDSLKKPVKEELLQRIREELERSGADYQLPLEQLIQRIVSTPEPYLRERREVK
FT                   VQPVANVMAAGVLKTVTAPMPLILLQDKDVELKMLRSFDASEQRKTRSDKSASEILGTF
FT                   GGVTIESTPE"
     atggctaaaa acttcatttc agaacaattc tcggccatgt gccgggactt aacgaacctg        60
     tcttccatta tcaaacgact accaccacgg tacgcaaaag ttgcggccat cccccctacc       120
     agaaagggaa tggagaatga gcgtatcaac aatattgtcg tgacggaaca aataggacgc       180
     gaagctcttg agctcgcagc gcatagctac aaagatctgc acatcaatcc agactattcg       240
     caaaagtctg ccagacgcac agtgggggtc ctatggtttt ccccttccaa agtcgggctg       300
     gctgctaaaa ttgctgcgac agttgatcgt atcaatgcgg ccaaagccgg tatagaagag       360
     ttcattatct ctacataccc ctccaggcaa gagcggtttg aagcacttcg agtagattgc       420
     cctggagtaa tgacacttca cctttacagg caaatccgat gctattccag tggcgacatc       480
     gactctatcc gcttcacctg gcaacggaag gactctttaa agaagccagt gaaagaagaa       540
     ctcttgcaac gaataagaga ggagcttgaa cgttctggtg ctgactatca gcttcccctt       600
     gaacaactga tccagaggat agtcagcact ccagagcctt acctccggga gcgaagggag       660
     gtaaaagtgc agccggtagc aaacgtcatg gccgcaggcg tactcaaaac cgttaccgcg       720
     cccatgcccc tgatcctgct gcaagacaag gatgttgagc tcaaaatgct tcgcagcttc       780
     gacgcatcag aacagcgcaa aacacgctcg gataagtcgg cttcggaaat ccttggcacc       840
     tttggcggcg tcaccattga atctacccct gagtaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page