(data stored in ACNUC30630 zone)

EMBL: FP565814.BIRA

FP565814.BIRA        Location/Qualifiers
FT   CDS_pept        complement(744021..744818)
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="SRM_00612"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /function="BirA acts both as a biotin-operon repressor and
FT                   as the enzyme that synthesizes the corepressor, acetyl-
FT                   CoA:carbon-dioxide ligase."
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00612"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23533"
FT                   /db_xref="GOA:D5H678"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D5H678"
FT                   /protein_id="CBH23533.1"
FT                   /translation="MSLPLAADTQGRLSTDRFGRSMRGFEEVGSTNERAAQWAAAGAPE
FT                   GATVLTEYQTTGRGRHGRDWTADKGRNLLFSVVLRPTLPPDRFGLLTVAAGVAVAEAIE
FT                   DFVSPHSAALKWPNDVLLEGRKACGILLESSLAPPNTDAVVVLGVGLNVNQTDFPDALA
FT                   DTATSLRLASGRPLPRPPLLARLLRALERRYDAVQHNGAGSVRGAFRERLAALGSSLSL
FT                   RLPGTDETLSGTVQGITETGALRLRTADGVEKTVHAGEVTTRR"
     atgtccctcc ctctcgccgc ggacacgcag ggtcggctct ccaccgaccg cttcggccgg        60
     tcgatgcgcg gattcgagga ggttggctcg acgaacgaac gggcggcgca gtgggccgca       120
     gcgggcgcgc cggagggcgc cacggtgctt accgaatacc agaccaccgg acgggggcgc       180
     cacgggcgcg actggaccgc cgacaagggc cgcaaccttc tcttctccgt ggtgctccgt       240
     cccacgctgc cgccggaccg gtttgggctt ctcactgtgg ccgcgggcgt ggccgttgcc       300
     gaggcgattg aggacttcgt ctcgccccac tcagccgccc tcaagtggcc caacgacgtt       360
     cttctagagg gccgcaaggc ctgtggcatc ctgctggagt cgtctctggc cccgcccaac       420
     accgacgccg tcgtcgtgct gggggtcggc ctcaacgtca accaaaccga ctttcccgac       480
     gccctcgccg acacggccac gtcgctccgc ctcgccagcg gccgccccct gccgcgccct       540
     cccctcctgg cccggctgct ccgggccctc gaacgtcggt acgacgccgt acagcacaac       600
     ggggccggct cagtccgcgg cgcgttccgg gagcgccttg ccgccctcgg gtcctccttg       660
     tccctgcgcc tccccggcac cgacgagacc ctctcgggca ccgtgcaggg catcacggag       720
     accggggccc tgcggctgcg cacggcagac ggggtggaga aaacggtgca cgcgggtgag       780
     gttacgaccc ggcgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page