(data stored in ACNUC30630 zone)

EMBL: FP565814.DEAD

FP565814.DEAD        Location/Qualifiers
FT   CDS_pept        42267..43703
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="SRM_00044"
FT                   /product="Cold-shock DEAD-box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22965"
FT                   /db_xref="GOA:D5H4L0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L0"
FT                   /protein_id="CBH22965.1"
FT                   /translation="MAADISQSKYTNVIDLTSEAQQERRRDEVGSELREPDPPLDEVTV
FT                   DALSGHMEQAVHAAGWTELMDVQRKAIPYTLDGRDLIVQSQTGSGKTGAFLLPLFDLVN
FT                   PDKEEQQVLILTPTRELARQIHEEFEQMKIATPRTNRMEAVLIYGGVGYQPQIDGLKNG
FT                   AQVVIGTPGRILDHIKKDNFDASTLRMLVLDEADEMLSMGFYPDMKDIVEHVPGDRVSY
FT                   MYSATMPPKVRSVAREFLDDPGFLSLSTDKVSVEENEYRYYLVNPMDKDRVMAQLLELE
FT                   EPESALIFANTKREVSYLNKFLSNKGYDIDEMSGDLSQRDREEALDRLREGKLRLLVAT
FT                   DVAARGIDVSDLSHVFIYDVPQDHEYIIHRSGRTARAGEEGTTIVLSTHEDEYELKRMA
FT                   NTYDIELEKAELPADPHSEARELLQERYANAEAPANGEEPGVEDFVPLVKELSDEQPEL
FT                   LASLITELYAEAKTEDEEEK"
     atggctgccg atatttcgca gagcaagtac acgaacgtca tcgacctgac ttctgaggcc        60
     caacaggagc ggcggcgcga cgaggttggg tcggagctgc gcgagccgga cccgcccctg       120
     gacgaggtca cggtcgacgc gctgtccggg cacatggagc aggcggtgca cgccgccggc       180
     tggacggagc tgatggacgt gcagcgcaag gccatcccct acaccctcga cgggcgcgac       240
     ctgatcgtgc agtcgcagac cggctcgggc aagaccggcg ccttcctgct gccgctgttc       300
     gacctggtga acccggacaa ggaggaacag caggttctca tcctcacgcc cacccgggag       360
     ctggcgcggc agatccacga ggagttcgag cagatgaaaa tcgcgacgcc gcgcacgaac       420
     cgcatggagg cggtcctcat ttacggcggc gtcgggtacc agccgcagat cgacggcctg       480
     aagaacggcg cgcaggtcgt catcggcacg ccgggccgca tcctcgacca catcaagaag       540
     gacaacttcg acgccagcac cctccggatg ctcgtgctcg acgaggccga cgagatgctg       600
     tcgatgggct tctacccgga catgaaggac atcgtcgagc acgtgccggg ggatcgggtc       660
     tcgtacatgt acagcgccac catgccgccg aaggtgcggt ccgtggcgcg cgaattcctg       720
     gacgacccgg gcttcctctc gctcagcacc gacaaggtga gcgtggagga gaacgagtac       780
     cgctactacc tggtcaaccc gatggacaag gatcgggtga tggcgcagct cctggagctg       840
     gaggagccgg agtcggccct catcttcgcc aacacgaagc gggaggtgag ctacctcaac       900
     aagttcctct cgaacaaggg ttacgacatc gacgagatgt ccggcgacct ctctcagcgc       960
     gaccgggagg aggcgctcga tcgactccga gaagggaagc tccgcctgct ggtggcgacg      1020
     gacgtggcgg cccgcggcat cgacgtgtcc gacctgagcc acgtcttcat ctacgacgtg      1080
     ccccaggacc acgagtacat catccaccgc tccggccgca cggcgcgggc cggcgaagag      1140
     ggcacgacga tcgtcctctc cacccacgag gacgagtacg agctcaagcg gatggctaac      1200
     acctacgaca tcgagctcga gaaggccgag ctgccggccg atccgcacag cgaggcccgt      1260
     gagctgctcc aggagcgcta cgcgaacgcc gaggccccgg ccaacggcga agagccgggc      1320
     gtcgaggact tcgtcccgct cgtgaaagag ctttccgacg aacagccgga actgctggcg      1380
     tccctcatca cggagctgta cgccgaagcg aagacggagg acgaggagga gaagtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page