(data stored in ACNUC30630 zone)

EMBL: FP565814.DNAA

FP565814.DNAA        Location/Qualifiers
FT   CDS_pept        225..1799
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SRM_00002"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /function="Plays an important role in the initiation and
FT                   regulation of chromosomal replication. Binds to the origin
FT                   of replication; it binds specifically double-stranded DNA
FT                   at a 9 bp consensus (dnaA box): 5'-TTATC[CA]A[CA]A-3'. DnaA
FT                   binds to ATP and to acidic phospholipids."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22923"
FT                   /db_xref="GOA:D5H4G8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4G8"
FT                   /protein_id="CBH22923.1"
FT                   /translation="MDQSADRAWNECLDIIRDNVSRQSFTTWFEPLEAHSLEDEDDLRK
FT                   LTIQLPSRFYYEWIEEHYFSLLRKTVTRVLGPHGRLFYDVVIEQDDPEDPDRGASMQLP
FT                   ARPADPESAPPPNAPDEPEAPPSSSEASAPSSEPSAPAPSGDEARPDDAQAGAEGDEKS
FT                   APPVQNPFAIPGLKNAEVDNQLNDSYTFDRFIEGECNRLARSAAHSIATDPGETSFNPF
FT                   LVYGGVGLGKTHLIQAIGNHVAARDASKTVFYVSSERFTTEFVQSIQENQIGEFSTFYR
FT                   QVDVLIVDDVQFFGGKEKTQEEFFHIFNALRQAGNQIVLSADRPPREIDGLEERLLSRF
FT                   QWGLSADLKPPGLDTRISILRRKAEDDGIDLDDDVVEFIAQSIESNIRELEGALIRLLA
FT                   HATLHQLDITLDLAKEVLHDLFQERAATLTVDDIQRIVCEHLGISQEKMRGKTRKRDVT
FT                   RARQIAMYFTKKHTQHSLKDIGLHFGGRDHSTVIHANNAVEDRMADDESFRDTVDAIGQ
FT                   KLERHGQ"
     atggatcagt ccgccgaccg cgcctggaac gaatgtctcg acatcatccg ggacaatgtg        60
     agccgccaga gcttcacgac ctggtttgag ccgctggagg cccactcctt ggaggacgaa       120
     gacgacctgc gcaagctgac gatccaactt ccgagccggt tttactacga gtggattgag       180
     gagcattact tctctctgct ccgaaagacg gtcacgcggg tgctcggccc ccacggccgt       240
     ctgttctacg acgtggtcat cgagcaggac gacccggagg acccagaccg gggcgcctcc       300
     atgcagcttc cggcccggcc ggccgacccg gagtcggctc cgccccccaa cgcgccggac       360
     gagccggagg cgccgcccag ttcgtcggag gcttccgcgc cgtcctcgga gccgtccgcg       420
     cccgccccgt ccggcgatga agcccgccct gacgacgcgc aggcaggcgc cgagggcgac       480
     gagaaaagcg cccccccagt ccagaacccg tttgccatac cgggcctgaa gaacgccgag       540
     gtcgacaacc agctcaacga cagctacacg ttcgaccgct tcatcgaggg ggagtgcaac       600
     cgcctcgctc gcagcgccgc ccactccatc gctaccgatc cgggcgaaac gagctttaat       660
     ccgtttctcg tgtacggcgg cgtgggactc ggcaagaccc acctcattca ggccatcggg       720
     aaccacgtcg cggcccggga cgcctcgaaa accgtcttct acgtttccag tgaacggttc       780
     accacggagt tcgtccagtc gatccaggaa aaccagatcg gcgagttttc gacgttctac       840
     cggcaggtcg acgtgctcat cgtggacgac gtgcagtttt tcggcggcaa ggagaaaacc       900
     caggaggagt tcttccacat tttcaacgcc ctccggcagg cgggcaacca aattgtgctg       960
     tcggcggacc gtccgccgcg cgagatcgac ggccttgagg aacggttgct gtctcgcttt      1020
     cagtggggcc tctccgccga cctgaagccc ccaggcctcg acactcgcat ctccattctc      1080
     cgccgcaagg ccgaggacga cgggatcgac ctcgacgatg acgtcgtcga gtttattgcc      1140
     cagagcatcg aaagcaacat ccgtgagctc gaaggcgcgc tgatccgcct tctggcccac      1200
     gccaccctcc accagctcga catcaccctc gacctcgcca aagaggtgct ccacgacctc      1260
     tttcaggagc gggccgccac cctcacggtc gacgacattc aacgcatcgt ttgcgagcac      1320
     ctcggcatct cgcaggagaa aatgcggggc aagacccgca agcgagacgt cacccgcgcc      1380
     cgtcagatcg caatgtactt caccaagaag cacacccagc actccctgaa agacatcggc      1440
     ctccatttcg gcgggcggga ccactcgacc gtcattcacg ccaacaacgc cgtggaggac      1500
     cggatggcgg acgacgagtc gttccgggac acggtggatg ccatcgggca gaagctcgaa      1560
     cgccacggcc aatga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page