(data stored in ACNUC30630 zone)

EMBL: FP565814.ETP

FP565814.ETP         Location/Qualifiers
FT   CDS_pept        716470..716874
FT                   /transl_table=11
FT                   /gene="etp"
FT                   /locus_tag="SRM_00583"
FT                   /product="Low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /function="Dephosphorylates etk"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23504"
FT                   /db_xref="GOA:D5H649"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H649"
FT                   /protein_id="CBH23504.1"
FT                   /translation="MSAQYLFVCTGNTCRSPLAEALAEARGVSAESAGVAAGPGDGAAP
FT                   NADRALREARGLSLRGHTPRDVSAVDLTAAGRIVAMSPAVARRLRDDHDWAPDAMVTWA
FT                   VPDPYGGSLADYRWCLEEISAALDDLLASG"
     atgagcgcac aatatctctt tgtctgtacg ggcaacacgt gccggagtcc cctggccgaa        60
     gccctcgcgg aggcgcgggg cgtgtcggcc gagagtgcag gggtggccgc gggcccgggc       120
     gacggggcgg cgccgaatgc agatcgagcc ctgcgcgagg cgcgagggct gtcgctacgg       180
     ggccacacgc cccgcgacgt gtctgcggtg gacctgacgg cggccgggcg gatcgtggcc       240
     atgagtccgg cggtggcgcg ccgactccga gacgatcacg actgggcccc cgacgcgatg       300
     gtcacctggg ccgtccccga cccctacggc gggtcgctcg ccgactaccg gtggtgcctc       360
     gaagagatca gcgcggccct ggacgatctg ctcgcatcgg ggtag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page