(data stored in ACNUC30630 zone)

EMBL: FP565814.LOLC

FP565814.LOLC        Location/Qualifiers
FT   CDS_pept        19908..21167
FT                   /transl_table=11
FT                   /gene="lolC"
FT                   /locus_tag="SRM_00020"
FT                   /product="Lipoprotein releasing system transmembrane
FT                   protein lolC"
FT                   /function="Part of an ATP-dependent transport system lolCDE
FT                   responsible for the release of lipoproteins targeted to the
FT                   outer membrane from the inner membrane. Such a release is
FT                   dependent of the sorting-signal (absence of an Asp at
FT                   position 2 of the mature lipoprotein) and of lolA ."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22941"
FT                   /db_xref="GOA:D5H4I6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I6"
FT                   /protein_id="CBH22941.1"
FT                   /translation="MDYRFQIARRYLASRREVSLISIITGISTVGVTLGVASLIVVLSV
FT                   MNGFYDVVRDVLVSLDPHVRVVSAQGEGVANVDSLLRVARETRHVTAAAPYVEGKALLM
FT                   SDNTGDANRVVRVRGVEASMMEGAAPTTAMGRFDLSRNADGVPGVVLNQRLGQRAGLVP
FT                   AGRTQSSTAVGLLSAPAVERTLTNIFGSPPVRRFEVRGLFQSQGTSQGQRVFVSLAEAQ
FT                   QLFRTEGRVTGVELRLDNLERAAGVKAALQRKLGTDRYTVQTWYDLQRSLYDVMQLEKW
FT                   GASAILGLIVIVAAFNIVGSLTMVVIEKRADVGALQAMGVSRGDVRRIFLLEGALIGAL
FT                   GTGLGLVLGLGLAFLQQHYGLVPMAQAESFLIDAYPVSVQALDVVLIAVVSFGLCVLAA
FT                   LYPAVRAAAIEPARAVHLDC"
     gtggactacc ggttccaaat cgcgcggcgc tacctggcca gccgacgtga ggtgtcgctc        60
     atctcaatca tcaccggcat ctcgacggtg ggggtgaccc tcggggttgc gtcgctcatc       120
     gtggtgcttt ccgtgatgaa cgggttttac gacgtcgtgc gggacgttct cgtgtcgctc       180
     gatccgcacg tccgggttgt gagtgcgcag ggagaaggcg tcgccaacgt ggactcgctt       240
     ctccgcgtcg cccgcgagac ccggcacgtg acggccgcgg cgccctacgt ggagggcaag       300
     gccctgctga tgagcgacaa cacgggcgac gccaatcggg tggtgcgcgt ccggggggtg       360
     gaggcgtcca tgatggaggg ggcggccccg acgacggcca tggggcgctt cgacctgagc       420
     cggaatgcgg acggggtgcc gggggtcgtg ctgaatcagc gacttgggca gcgcgccggg       480
     ctcgtgccgg cgggccggac ccagtcgagt accgcggtgg ggttgctgtc ggcaccggcc       540
     gtggagcgca ccctcacgaa catctttgga agcccgccgg tgcggcgctt cgaggtgcga       600
     gggctcttcc agtcgcaggg gacctcgcag ggccagcgcg tcttcgtgtc gctggcggag       660
     gcgcagcagc tgtttcggac cgagggccgg gtgaccgggg tggagctccg cctcgacaac       720
     ctggaacggg ccgcgggcgt gaaggccgcc ctgcagcgga agctcgggac cgaccggtac       780
     accgtgcaga cgtggtacga ccttcagcgg tcgctctacg acgtgatgca gctggagaag       840
     tggggtgcgt cggccatcct cgggctcatc gtgatcgtag cggccttcaa catcgtcggc       900
     tccctgacga tggtggtgat cgaaaagcgg gccgacgtgg gggccctcca ggccatgggc       960
     gtgtctcggg gagacgtgcg tcgcattttc ctgctcgaag gggcgctcat cggcgcgctc      1020
     ggaacggggc tgggcctcgt cttgggactg gggcttgcct ttctgcagca gcactacgga      1080
     cttgtgccga tggcccaggc cgagtcgttt ctcatcgacg cctatccggt gtcggtacag      1140
     gcgctcgacg tggtgctcat cgcggtcgtt tcgtttgggc tttgtgtgct ggccgccctg      1200
     tatccggccg ttcgggcggc cgccatcgag ccggcccggg ccgtgcacct ggactgctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page