(data stored in ACNUC30630 zone)

EMBL: FP565814.MAOC

FP565814.MAOC        Location/Qualifiers
FT   CDS_pept        complement(74662..75108)
FT                   /transl_table=11
FT                   /gene="maoC"
FT                   /locus_tag="SRM_00070"
FT                   /product="putative phosphate acetyltransferase/enoyl-CoA
FT                   hydratase fusion protein"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22991"
FT                   /db_xref="GOA:D5H4N6"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N6"
FT                   /protein_id="CBH22991.1"
FT                   /translation="MVNTYESIEIGDSHEWTRVVTAEDVKKFADITGDDNPVHVDPDYA
FT                   EEHSRFGKPIVHGVLLLGLISKVLGRDFPGHGSIAVGISCRFLRPVPVGSEVRVQVKVS
FT                   EKIEDKKHVKLRTYIYRDDQMVVGGEGRVIPPTEEEEDPHRARR"
     atggtcaaca cctacgaatc gattgagatt ggcgactccc acgagtggac acgggtcgtc        60
     acggcggagg acgtgaagaa gttcgccgac atcacgggcg acgacaaccc cgtgcacgtc       120
     gatccggact acgcggaaga acactcccga ttcggcaagc ccatcgtcca cggcgtgctc       180
     ctgctcggcc tcatctcaaa ggtgctgggc cgcgactttc ccgggcacgg cagcatcgcc       240
     gtcggcattt cgtgccgttt tctccgcccc gtcccggtcg gctccgaggt ccgcgtccag       300
     gtgaaggtct cggagaagat cgaggacaag aagcacgtca agttgcgcac gtacatctac       360
     cgggacgacc agatggtcgt cggcggcgag gggcgcgtca ttcccccgac ggaagaagag       420
     gaggatcccc accgggcccg ccgttag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page