(data stored in ACNUC30630 zone)

EMBL: FP565814.MVIM

FP565814.MVIM        Location/Qualifiers
FT   CDS_pept        complement(509988..511109)
FT                   /transl_table=11
FT                   /gene="mviM"
FT                   /locus_tag="SRM_00426"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23347"
FT                   /db_xref="GOA:D5H5P2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P2"
FT                   /protein_id="CBH23347.1"
FT                   /translation="MGERRRTRDWKRAARTLAHATHLPARRWPLNLQFPTVQSSPPSAN
FT                   NMAVNWGILGTGNIAHLVAEDLRRLPNAELTAVGSRAQARADTFGDTFDVPHRHGSYEA
FT                   LVADPALDVVHVATPHSAHLEHATLALEAGHAVLCEKPLALNAAQAERLIDTARRHDQF
FT                   LMEAMWTRFLPVMDDVHRLVHEERVLGDVHLLRADIGVTQPVDPTHRLFDPALGGGALL
FT                   DLGVYPVAFAFDLFGAPDTVTSSAVLADTGVDAQCAAVFRYDDGTQAMWHASLGADAGR
FT                   TCVLAGPEGRLRGTRAWWKGAPFELTRSDGATASWARPYEGNGYQFEAAHVMACLREGR
FT                   TESPVMPLDESHALLRTMDALRAEWGVAYPQEA"
     atgggggagc gtaggagaac gagagactgg aagagggcgg cgcggacact ggcgcatgcg        60
     acgcacctcc cggctcggag atggccactc aacctccaat tccccaccgt ccaatcctca       120
     ccaccttcag ccaacaacat ggccgtaaac tggggcatcc tgggtaccgg caacatcgcc       180
     cacctcgtcg ccgaggatct acgacgcctt cccaacgcag agctaaccgc cgtgggctct       240
     cgggcgcagg cccgggccga cacgttcggg gacacgttcg acgttccgca ccggcacggg       300
     tcctacgagg ccctcgtggc cgaccctgcc ctcgatgtcg ttcacgtagc gactccacac       360
     tcggcccacc tcgaacacgc caccctggcg ctggaggccg ggcacgccgt cctctgcgag       420
     aaacccctcg ccctgaacgc cgcgcaggcc gaacggctca tcgacaccgc ccggcggcac       480
     gaccagtttt tgatggaggc gatgtggacc cgcttcctcc ctgtcatgga cgacgtccac       540
     cgcctcgtgc acgaagaacg cgtcctcggc gacgtgcacc tgctccgggc cgacatcggc       600
     gtgacgcagc ccgtcgaccc gacccaccga ctcttcgacc ctgccctcgg cggcggggcg       660
     ctcctcgacc ttggcgtgta ccccgtggcg tttgccttcg acctgttcgg cgcgccggac       720
     acggtcacct cctcggccgt cctcgccgac accggcgtcg acgcgcaatg cgcggccgtc       780
     ttccgctacg acgacgggac gcaggcgatg tggcacgcct cgctgggggc cgacgccgga       840
     cggacctgcg tgcttgccgg cccggaggga cgcctgcggg gcacgcgggc ctggtggaag       900
     ggggccccgt ttgagctcac ccggagcgac ggcgcgacgg cgtcctgggc ccgcccgtac       960
     gaggggaacg gctaccagtt tgaggccgcc cacgttatgg cctgcctccg tgaggggcgc      1020
     acggagagcc ccgtgatgcc cctcgacgag agccatgccc tcctgcggac gatggacgcc      1080
     ctccgcgcgg aatggggcgt cgcgtatccc caggaggcgt ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page