(data stored in ACNUC30630 zone)

EMBL: FP565814.NUOF

FP565814.NUOF        Location/Qualifiers
FT   CDS_pept        579364..580725
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="SRM_00474"
FT                   /product="NADH:ubiquinone oxidoreductase, NADH-binding (51
FT                   kD) subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23395"
FT                   /db_xref="GOA:D5H5U0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U0"
FT                   /protein_id="CBH23395.1"
FT                   /translation="METNGTPQSPAGDWRSYERMLLPPIQDLHKLGVYEEHGGYDRLRR
FT                   VLEDDAFEPSDVTDEVKASGLTGRGGAGFPTGIKWTFMPEPDERPRFIGVNADESEPGT
FT                   FKDRQVMEYNPHLMLEGILLAGYALHIDTAYVYIRGEYTDWIVHLKEQLENAYEAGYVG
FT                   ENIMGSDFTMDIVLHKGAGAYICGEETSLMESLEGKRGYPRYKPPFPAQSGIFGSPTTI
FT                   NNAETLAHVPLIVEQGGEAYSNIGAGDMPGPALYGMSGHVKNPGVYEFPTGMLLTDMIY
FT                   DVCGGMARDKDLKAVVPGGSSVPPVPADQIDGISMNDESLGEVGSRTGTFCPLVLDEET
FT                   DMVSFLRRVAHFYQDETCGQCTPCREGTSWLEKILARIDEGEGRMRDIDLLLELCDNMD
FT                   GGRTICAFADGAVGPVRATVKRFREEFVAKCQASVHPVSTEVSAGAESAVAATE"
     atggaaacga acggaacgcc ccaaagtccg gccggcgact ggcgctcgta cgagcggatg        60
     ctgctgccgc ccattcagga cctccacaag ctgggcgtgt acgaggagca cggcggatac       120
     gaccgcctcc ggcgcgtcct tgaggacgac gcgttcgaac cgagcgacgt cacggacgag       180
     gtgaaggcct ccgggctcac cgggcgcggc ggggccggct ttcccaccgg gatcaagtgg       240
     accttcatgc cggagccgga cgagcgcccg cgcttcatcg gggtgaacgc ggacgagagc       300
     gagcccggca ccttcaagga ccgtcaggtg atggagtaca acccgcacct gatgctcgag       360
     ggcatcctgc tcgccgggta cgccctccac atcgacacgg cctacgtgta catccggggc       420
     gagtataccg actggatcgt gcacctgaag gagcagctgg agaacgccta cgaggcgggc       480
     tatgtgggcg agaacatcat gggctcggac ttcacgatgg acatcgtgct ccacaagggg       540
     gccggagcct acatctgtgg ggaggagacg agcctgatgg agagcctgga gggcaagcgc       600
     ggataccccc gctacaagcc gcccttcccg gcccagagtg gcatcttcgg ctcccccacg       660
     acgatcaaca acgccgagac gctggcgcac gtcccgctca tcgtggagca ggggggcgag       720
     gcgtactcga acatcggagc gggggacatg ccggggcccg ccctctacgg gatgtccggg       780
     cacgtgaaaa accccggcgt ctacgaattt ccgacgggca tgctgctgac cgacatgatc       840
     tacgacgtgt gcggcggcat ggcccgcgac aaggacctga aggccgtggt gccgggcggg       900
     tcgtcggtgc cgccggtgcc cgccgaccag atcgacggca tctcgatgaa cgacgagagc       960
     ctcggtgagg tgggctcgcg gacggggacg ttctgtccgc tcgtgctcga tgaggagacc      1020
     gacatggtct cgttcctccg ccgcgtggcg cacttctacc aggacgaaac ctgcgggcag      1080
     tgcacgccct gccgcgaggg cacgagttgg ctcgaaaaga tcctcgcccg catcgacgag      1140
     ggggaggggc gcatgcgcga catcgacctg ctcctggagc tgtgcgacaa catggacggg      1200
     gggcgcacca tctgtgcctt cgcggacggc gccgtggggc cggtgcgggc caccgtcaag      1260
     cgcttccgcg aggagtttgt ggcgaagtgc caggcgtccg tccaccccgt cagcaccgag      1320
     gtgtccgccg gcgccgagtc ggccgtggcg gcgacggagt ag                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page