(data stored in ACNUC30630 zone)

EMBL: FP565814.OTSB

FP565814.OTSB        Location/Qualifiers
FT   CDS_pept        complement(802438..803136)
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="SRM_00659"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /function="catalyse the de-phosphorylation of trehalose-6-
FT                   phosphate to trehalose and orthophosphate"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00659"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23580"
FT                   /db_xref="GOA:D5H6C5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C5"
FT                   /protein_id="CBH23580.1"
FT                   /translation="MPPVVEPPLFFLDYDGTLAPIVDDPAAAVPHPEAPDLLRNLDAQF
FT                   PLWIVTGRDLQALSSFLDRPYSAIGLHGAQEGVVGRDVHNRMSDEAAAALRRLRASVPS
FT                   VDGLRVEDKARSFAVHYREARDESGARDQLKDWLADLPEVLDAIWGKKVVELRPDGLTK
FT                   GTAVRRIAAQHPDHVPVYLGDDVTDEDAFAALQEMDRDTVSIKVGPGDTRADARLDGPD
FT                   AVMAYLSRYV"
     atgccccccg tcgttgaacc ccccctattt ttcctcgact acgacggcac ccttgccccc        60
     atcgtggacg acccggccgc ggcggtgccc caccccgagg ccccggacct gctccgcaac       120
     ctcgacgcgc agtttcccct ctggatcgtc acggggcgcg acctgcaggc cctctcctcg       180
     tttctcgatc gcccgtactc ggcgatcggg ctgcacgggg cgcaggaggg cgtcgtgggc       240
     cgggacgtcc acaaccgcat gtcggacgaa gccgccgcgg ccctccgccg cctccgcgcc       300
     tccgtgccgt cggtcgacgg gctccgggtt gaggacaagg cgcgctcctt tgcggtgcac       360
     taccgcgagg ccagggacga gtccggcgca cgggaccagc tcaaggactg gctcgccgac       420
     ctcccggagg ttctcgacgc catctggggc aagaaagtgg tggagctccg tccggacggg       480
     ttgacgaaag gcaccgccgt gcgccgcatc gcggcacagc accccgatca tgtgcccgtc       540
     tacctgggcg acgacgtgac ggacgaagac gcgttcgcgg cgctccagga gatggaccgg       600
     gacaccgtct ccattaaggt cggccccggc gacacgcggg ccgacgcccg actcgacggc       660
     cccgacgccg tcatggcgta cctgagccgg tacgtgtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page