(data stored in ACNUC30630 zone)

EMBL: FP565814.PE101

FP565814.PE101       Location/Qualifiers
FT   CDS_pept        complement(121373..124693)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00101"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23022"
FT                   /db_xref="GOA:D5H4R7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R7"
FT                   /protein_id="CBH23022.1"
FT                   /translation="MESDEPFSAPFSRSSFSEPAGWGPDTNAPAAVYADPGADVDPERS
FT                   FGRVLDLATRLFEAPMGIGTLHANGQPRVVAADGLRDAGLQDEGDGIKARLCTRTLRSP
FT                   GATVVTNATDDDRLADHPWVAGDPGIRFYAGTPLVGPQGHRIGSLCVLDTEAQSPPPAD
FT                   VDRLEGLAEMIVNELELHRQADAWDRARQQYEAIFNHTYQFTGLLTPDGILVEANDTAL
FT                   EFGGLEREEVVGTPFWDTHWWQTGPETQQKLRAAVEQAAEGEFVQYEADVQGADETRTI
FT                   DFSIRPVTDGDGSVTMLIPEGRDITDRKRQERQLRKEKQKTEEALQARDALLGSITENI
FT                   SEGIYRSTPDDGLVYANEALADMLRHRSVDALLEADPVHFYADPDQRAQVIQQSNRNDG
FT                   ITGVEVEFRRTDGTTFTGLLSATTVRGPDGAVQYYDGAVTEITEQKRQEQQLRRSRERW
FT                   RRLVEKLEDGLHISVDGEIRYINPAGAAIVGAETPEDIVGRSLQEFVVSERTQQDVVED
FT                   RLRTVYQERASTPPRELEIIGLDGARRVIESYTVPIEFDGEQAGQTVFRDITEQKEMEQ
FT                   ALREREARLRSITENVSDGIYRSTPNEGLVYANRAFADIFGYESVEAILQIDPIELYAN
FT                   PDARSENRRITKEQDHIDAAEAEFRRKDGSTFTGLVSATTVRDENGEVLYYDGAITDIT
FT                   EQKEQARTLRDRQQKLESLYTATRHLLRAETPDAVATRIQDVLQDVFDYPLAGVDFAED
FT                   GRLVPVEGAIASPGQMPTIQSLSAGGDSIGARAYRSGETVVVQNVEALDNDVAYGGLRS
FT                   VACAPMGTHGVVLMGQTSHDAFDAFNLRLVEVLVTYAAVVLDRLGREQKLREAKETAEQ
FT                   VNEMKSAFLANMSHEIRTPLTSIIGFAEAIGDEVSGGDPTVSRFAGLIEKGGRRLLETL
FT                   DAVLNLSKLEAEEMELALAPLNVAEQAADTGALFEQQAEKAGIDLRVDVPSGPLWARAD
FT                   EGALRIVLRNLVSNAVKYTGDGGRVWIRARRAEDQAVLEVEDTGQGMDPAAVSTLFEAF
FT                   KQASEGKGREYEGTGLGLAVTKQAVDQMEGTIDVDTEKGVGSRFVVRLPRPAPDETDA"
     atggagtcag acgagccctt ctccgctccg ttttctcgtt cctcgttttc ggagcctgcc        60
     ggctggggtc cagacacgaa cgcgcccgcg gcggtctacg ccgatccggg ggccgacgtg       120
     gatcccgagc gctcctttgg ccgtgtcctg gacctcgcca cccgtctctt cgaggccccg       180
     atggggatcg gcaccctcca cgcaaacggg cagccgcggg tcgtggccgc cgacgggctt       240
     cgcgatgcag gcctccagga cgagggcgac gggatcaagg cgcgcctctg cacgcggacg       300
     ctgcggtcgc cgggggcgac ggtcgttacg aacgccacgg acgacgaccg gctcgccgat       360
     cacccatggg tcgcggggga tcccgggatt cgcttttacg ccggcacccc attggtgggc       420
     ccgcagggcc accggattgg atcgctgtgc gtcctggaca ccgaggccca atctccgccg       480
     cccgcggacg tcgaccggct cgagggcctc gccgagatga tcgtcaacga gttggagctg       540
     caccgccagg ccgacgcgtg ggaccgggcc cggcagcagt acgaggccat cttcaaccat       600
     acctatcagt tcaccggcct gctaacgccc gacggcattc tcgttgaagc caacgacacg       660
     gccctcgagt ttggcgggct ggagcgggag gaggtcgtcg gaacgccgtt ctgggacacg       720
     cactggtggc agacgggccc agagacgcag cagaaactcc gggccgccgt cgaacaggca       780
     gccgagggcg agtttgtgca gtacgaggcg gacgtccagg gggccgacga gacgcggacg       840
     atcgacttct cgatccggcc ggttaccgac ggagacggat cggttacaat gctgattccc       900
     gagggccgcg acattaccga ccgcaagaga caagagcgcc aactccggaa ggaaaagcag       960
     aagaccgagg aggccctcca ggcccgcgac gccctgctcg ggtccatcac cgaaaacatc      1020
     tcggaaggca tctaccgctc gacgcccgac gacggcctcg tctacgccaa cgaggccctc      1080
     gccgacatgc tcaggcaccg gagcgtggat gccctcctgg aggccgatcc ggtccacttt      1140
     tacgccgatc ccgaccagcg ggcgcaggtc attcagcagt ccaaccgcaa tgacggcatc      1200
     accggggtcg aagtagaatt tcggcgcacg gacgggacga ccttcacggg cctgctgagc      1260
     gccacgaccg ttcgggggcc cgacggggcg gtgcagtact acgacggggc cgtgaccgag      1320
     atcaccgagc agaaacggca agagcagcag ctccggcgaa gccgcgagcg gtggcggcgc      1380
     ctcgtcgaga agctcgaaga cggactccac atctccgtcg acggggagat tcggtacatc      1440
     aacccggcgg gggccgccat cgtgggtgcg gagaccccgg aagacatcgt cggccgctcg      1500
     ctccaggagt tcgtggtctc ggaacgaacg caacaggacg tcgtcgagga tcgcctccgg      1560
     acggtctatc aggagcgggc atcgactccc ccacgagaac tggagatcat cggactggat      1620
     ggggcccgtc gcgtcatcga aagctacacg gtccccatcg agttcgacgg agaacaggcc      1680
     gggcagacgg tgtttcggga catcacggag cagaaagaga tggagcaggc gctccgcgag      1740
     cgggaggcgc ggctccgctc gatcaccgag aacgtctcgg acggcatcta ccgatccacc      1800
     cccaacgagg ggctcgtcta cgccaaccgg gccttcgccg acatcttcgg gtacgagagc      1860
     gtcgaggcga ttctacagat cgaccccatc gaattgtacg caaaccccga cgcccgcagc      1920
     gagaaccggc gcatcacgaa agaacaggac cacatcgacg ccgcggaggc ggaatttagg      1980
     cgcaaggacg ggtcgacgtt caccggcctc gtcagcgcca ccacagtccg cgacgagaac      2040
     ggcgaggtgc tgtactacga cggggccatc accgacatca ccgagcagaa agagcaggcc      2100
     cggacgctgc gggaccggca gcagaaactg gagtcgctgt acacggccac gcgccacctc      2160
     ttgagggccg aaacccccga tgcggtcgcg acccgcatcc aggacgtact ccaggacgtg      2220
     ttcgactatc ccctggcggg cgtcgacttc gcggaggacg gccggctcgt cccggtcgaa      2280
     ggcgcaatcg cgtcccccgg tcagatgcca acgatccagt cgctctcggc tgggggggac      2340
     agcatcggcg cccgggcata ccggtccgga gagaccgtgg tggtgcagaa cgtagaggcc      2400
     ctcgacaacg acgtggcgta cggcgggctg cgctcggtgg cctgcgcccc catgggcacg      2460
     cacggggtcg tgctcatggg acagacgtca cacgacgcgt ttgacgcgtt caacctgcgc      2520
     ctggtcgagg tgctggtgac ctacgccgcc gtggtgctcg accgcctggg ccgggagcaa      2580
     aagctgcgtg aggcaaagga gaccgccgag caggtcaacg aaatgaagtc ggccttcctg      2640
     gccaacatga gccacgagat ccgcacgccc ctgacctcga tcatcggatt cgcggaggcg      2700
     atcggggacg aggtgagcgg aggggacccc accgtgtccc gatttgcggg cctcattgag      2760
     aaggggggac ggcgcctgct cgagacgctc gacgcggtgt tgaacctgtc gaagctggag      2820
     gccgaggaga tggagctcgc ccttgccccg ctcaacgtgg ccgagcaggc tgcggacacg      2880
     ggggccctct tcgaacagca ggccgaaaag gccggcatcg atctgcgggt ggacgtgccc      2940
     tcgggtcccc tctgggcgcg ggccgacgag ggggcgctgc gcatcgtgct gcgcaatctg      3000
     gtgtcgaacg cggtcaagta caccggcgac gggggacggg tctggatccg ggcccggagg      3060
     gccgaggatc aggcggtctt ggaggtggag gacaccggac aagggatgga tccggcggcg      3120
     gtttcgaccc tcttcgaagc gttcaagcag gcctcggagg gcaaggggcg ggagtacgaa      3180
     ggaacgggct tgggactggc cgtcaccaaa caggccgtcg accagatgga gggcacgatc      3240
     gacgtcgaca ccgagaaagg ggtgggcagc cgctttgtcg tacgcctgcc ccggccggca      3300
     ccggacgaaa cggacgcgta g                                                3321
//

If you have problems or comments...

PBIL Back to PBIL home page