(data stored in ACNUC30630 zone)

EMBL: FP565814.PE108

FP565814.PE108       Location/Qualifiers
FT   CDS_pept        129676..130497
FT                   /transl_table=11
FT                   /locus_tag="SRM_00108"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing CAAX amino terminal protease domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23029"
FT                   /db_xref="GOA:D5H4S4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S4"
FT                   /protein_id="CBH23029.1"
FT                   /translation="MLIYAIRTTQYEMDPPDRRAVPSRNCPPSSPRSSPMPSWHAYHRA
FT                   TRSATYGFLSALPLFVLYETMIVLVNLDATRPVRVEAGVWIKELLMMTGASGGLGLALL
FT                   VVGGGGAAYLLDRHRDIPLRSRYFVGLVGESAAYAVGVALVVSSAVGALFAAIPPADGV
FT                   LWTQLALSIGAGLYEELVFRVLLVGGLFLLFRALMETSTRVYLVAALLGAALFSGAHYV
FT                   GPLGDPFALPSFAFRFLFGLALNALFLARGFGVAAWTHALYDVMVVTGMLG"
     ttgctgatat acgcaatacg cactacgcag tacgaaatgg atccacctga tcggcgagca        60
     gtcccctccc ggaactgccc tccttcttca ccgcgttcgt cccccatgcc ctcctggcac       120
     gcatatcacc gagccacccg ctcggccaca tacggcttcc tcagcgccct gccgctcttt       180
     gtgctctacg agacgatgat tgtgctcgtg aacctcgacg ccacgcggcc ggtgcgggtg       240
     gaggcgggcg tgtggatcaa ggagctgctc atgatgaccg gggcgtccgg cgggctgggc       300
     ctcgcgttgc tcgtggtggg gggcggtggg gccgcctacc tgctggatcg gcaccgcgac       360
     attccgctgc ggtcgcgcta cttcgtcggg cttgtgggcg agagcgcggc gtacgcggtc       420
     ggtgtggccc tcgtcgtctc gtcggccgtc ggggccctct tcgccgcgat cccgcccgcc       480
     gacggggtgc tctggacgca gctggccctc tccatcggcg cgggcctcta cgaagagctg       540
     gtcttccggg tgctgctcgt gggggggctc ttcctccttt ttcgggccct gatggagaca       600
     tcgacccggg tgtacctggt ggcggccctt ctcggggcgg cgctcttcag cggggcgcac       660
     tacgtaggtc ccctgggcga cccatttgcg ctgccgtcgt ttgcctttcg gttcctcttc       720
     ggcctggccc tcaacgccct cttcctcgcc cgtggcttcg gcgtcgccgc ctggacccac       780
     gcgctctacg acgtgatggt ggtgacgggg atgcttgggt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page