(data stored in ACNUC30630 zone)

EMBL: FP565814.PE116

FP565814.PE116       Location/Qualifiers
FT   CDS_pept        142393..143118
FT                   /transl_table=11
FT                   /locus_tag="SRM_00116"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23037"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T2"
FT                   /protein_id="CBH23037.1"
FT                   /translation="MQSAGPARDSFARFLPSLALPSLKNYRVMTRSVRSLGLPLALALL
FT                   LLGGTVVPSQAQIGVSAGLNFEEAGDIKNAAGNTDAALSTATGYHFGLSFEFGTDRFRL
FT                   RPGILFRNVGTYDLSPDAGAQDATREFDVSVIEIPLDLRMKALPIPYVNPYIMAGPMVA
FT                   LPRSEGDFSDATRDWSLSGNVGAGLSLSISSVKVQPEVRYQFGLTNYISDSFTVGSETI
FT                   NPADSPEFSAFSARLTFMF"
     atgcaaagcg ccggtccagc tcgagattcc ttcgcgcgat ttctgccatc actcgctctg        60
     ccatcactca agaactaccg agtcatgact cgttccgtcc gatccctcgg cttgcccctc       120
     gcgctcgccc tcctgctgct cgggggcacc gtcgtgccgt cccaggccca gatcggcgtg       180
     tcggcggggc ttaacttcga ggaggccggc gacatcaaga acgccgccgg caacacggac       240
     gcggccctca gcactgccac tggctaccac ttcgggctct cctttgagtt cggcaccgat       300
     cggtttcggc tgcggcccgg gattctgttc cgcaacgtgg gcacctacga cctgtcgccg       360
     gacgcgggcg cccaggacgc cacccgggag ttcgacgtga gtgtaattga gattccgctc       420
     gacctccgga tgaaggcgct ccccatcccc tacgtcaacc cgtacatcat ggcggggccc       480
     atggtggcgt tgccacggag cgagggggac ttcagcgacg ccacgcggga ctggtccctc       540
     tccggaaacg tgggggccgg cctcagcctc tccatctcct cggtgaaagt tcagcccgag       600
     gtgcggtacc agttcggcct caccaactac atctcggaca gcttcacggt cgggagcgag       660
     acgatcaatc cggcggacag tccggagttt agtgccttca gcgcccggct gaccttcatg       720
     ttttga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page