(data stored in ACNUC30630 zone)

EMBL: FP565814.PE118

FP565814.PE118       Location/Qualifiers
FT   CDS_pept        143916..144416
FT                   /transl_table=11
FT                   /locus_tag="SRM_00118"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T4"
FT                   /protein_id="CBH23039.1"
FT                   /translation="MIRTLRTFALLSIFALLLSAPAQGQSLRYGTGLQVMGSTAVASVS
FT                   PGFHFRTTLPITQDLSLGGGLGLAGFVFEGQSNAVYAVDPEVSLIVTIPTPSRSATYLL
FT                   GGGGYHVPFGNDPPASGPSFHLGLGRIWALQETTLFLEFTSALYVRDSSAGGLFPIRGG
FT                   VIF"
     atgattcgga ctctccgtac gtttgctctc ctcagcattt tcgccctgct gctctccgcg        60
     cccgcacagg ggcagtcgct ccggtacggc acgggactgc aggtcatggg aagcacggcc       120
     gtcgcgagcg tgagccccgg cttccacttc cgcaccacgc ttcccatcac gcaggacctc       180
     tcgctgggcg gtgggctcgg gctggcgggc ttcgtcttcg agggccagtc gaacgctgta       240
     tacgccgtgg atcccgaggt gtccctcatc gtcacgattc ccacgccgag ccggtccgcc       300
     acgtacctgc tgggcggcgg tgggtaccac gtgcccttcg gcaacgatcc tccagccagc       360
     gggcccagct tccaccttgg cctcgggcgc atctgggccc tgcaggagac caccctcttt       420
     ctggagttta cctcggcgct ctatgtccgg gacagttcgg cgggcggcct ctttcccatc       480
     cgcggcggcg tcatcttcta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page